data_2KAT # _entry.id 2KAT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KAT pdb_00002kat 10.2210/pdb2kat/pdb RCSB RCSB100891 ? ? BMRB 16030 ? ? WWPDB D_1000100891 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 16030 BMRB unspecified . BpR206 TargetDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KAT _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-11-14 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wu, Y.' 1 'Mills, J.L.' 2 'Wang, D.' 3 'Jiang, M.' 4 'Foote, E.L.' 5 'Xiao, R.' 6 'Sathyamoorthy, B.' 7 'Sukumaran, D.' 8 'Nair, R.' 9 'Everett, J.K.' 10 'Swapna, G.' 11 'Acton, T.B.' 12 'Rost, B.' 13 'Montelione, G.T.' 14 'Szyperski, T.' 15 'Northeast Structural Genomics Consortium (NESG)' 16 # _citation.id primary _citation.title 'Solution structure of protein BPP2914 from Bordetella parapertussis. Northeast Structural Genomics Consortium target BpR206' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wu, Y.' 1 ? primary 'Mills, J.L.' 2 ? primary 'Wang, D.' 3 ? primary 'Jiang, M.' 4 ? primary 'Foote, E.L.' 5 ? primary 'Xiao, R.' 6 ? primary 'Sathyamoorthy, B.' 7 ? primary 'Sukumaran, D.' 8 ? primary 'Nair, R.' 9 ? primary 'Everett, J.K.' 10 ? primary 'Swapna, G.' 11 ? primary 'Acton, T.B.' 12 ? primary 'Rost, B.' 13 ? primary 'Montelione, G.T.' 14 ? primary 'Szyperski, T.' 15 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'uncharacterized protein' _entity.formula_weight 13089.693 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation M4I _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MQAITERLEAMLAQGTDNMLLRFTLGKTYAEHEQFDAALPHLRAALDFDPTYSVAWKWLGKTLQGQGDRAGARQAWESGL AAAQSRGDQQVVKELQVFLRRLAREDALEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MQAITERLEAMLAQGTDNMLLRFTLGKTYAEHEQFDAALPHLRAALDFDPTYSVAWKWLGKTLQGQGDRAGARQAWESGL AAAQSRGDQQVVKELQVFLRRLAREDALEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier BpR206 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLN n 1 3 ALA n 1 4 ILE n 1 5 THR n 1 6 GLU n 1 7 ARG n 1 8 LEU n 1 9 GLU n 1 10 ALA n 1 11 MET n 1 12 LEU n 1 13 ALA n 1 14 GLN n 1 15 GLY n 1 16 THR n 1 17 ASP n 1 18 ASN n 1 19 MET n 1 20 LEU n 1 21 LEU n 1 22 ARG n 1 23 PHE n 1 24 THR n 1 25 LEU n 1 26 GLY n 1 27 LYS n 1 28 THR n 1 29 TYR n 1 30 ALA n 1 31 GLU n 1 32 HIS n 1 33 GLU n 1 34 GLN n 1 35 PHE n 1 36 ASP n 1 37 ALA n 1 38 ALA n 1 39 LEU n 1 40 PRO n 1 41 HIS n 1 42 LEU n 1 43 ARG n 1 44 ALA n 1 45 ALA n 1 46 LEU n 1 47 ASP n 1 48 PHE n 1 49 ASP n 1 50 PRO n 1 51 THR n 1 52 TYR n 1 53 SER n 1 54 VAL n 1 55 ALA n 1 56 TRP n 1 57 LYS n 1 58 TRP n 1 59 LEU n 1 60 GLY n 1 61 LYS n 1 62 THR n 1 63 LEU n 1 64 GLN n 1 65 GLY n 1 66 GLN n 1 67 GLY n 1 68 ASP n 1 69 ARG n 1 70 ALA n 1 71 GLY n 1 72 ALA n 1 73 ARG n 1 74 GLN n 1 75 ALA n 1 76 TRP n 1 77 GLU n 1 78 SER n 1 79 GLY n 1 80 LEU n 1 81 ALA n 1 82 ALA n 1 83 ALA n 1 84 GLN n 1 85 SER n 1 86 ARG n 1 87 GLY n 1 88 ASP n 1 89 GLN n 1 90 GLN n 1 91 VAL n 1 92 VAL n 1 93 LYS n 1 94 GLU n 1 95 LEU n 1 96 GLN n 1 97 VAL n 1 98 PHE n 1 99 LEU n 1 100 ARG n 1 101 ARG n 1 102 LEU n 1 103 ALA n 1 104 ARG n 1 105 GLU n 1 106 ASP n 1 107 ALA n 1 108 LEU n 1 109 GLU n 1 110 HIS n 1 111 HIS n 1 112 HIS n 1 113 HIS n 1 114 HIS n 1 115 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene BPP2914 _entity_src_gen.gene_src_species coli _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bordetella parapertussis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 519 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species coli _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET 21-23C' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q7W6J5_BORPA _struct_ref.pdbx_db_accession Q7W6J5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MQAMTERLEAMLAQGTDNMLLRFTLGKTYAEHEQFDAALPHLRAALDFDPTYSVAWKWLGKTLQGQGDRAGARQAWESGL AAAQSRGDQQVVKELQVFLRRLAREDA ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KAT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 107 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q7W6J5 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 107 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 107 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KAT ILE A 4 ? UNP Q7W6J5 MET 4 'engineered mutation' 4 1 1 2KAT LEU A 108 ? UNP Q7W6J5 ? ? 'expression tag' 108 2 1 2KAT GLU A 109 ? UNP Q7W6J5 ? ? 'expression tag' 109 3 1 2KAT HIS A 110 ? UNP Q7W6J5 ? ? 'expression tag' 110 4 1 2KAT HIS A 111 ? UNP Q7W6J5 ? ? 'expression tag' 111 5 1 2KAT HIS A 112 ? UNP Q7W6J5 ? ? 'expression tag' 112 6 1 2KAT HIS A 113 ? UNP Q7W6J5 ? ? 'expression tag' 113 7 1 2KAT HIS A 114 ? UNP Q7W6J5 ? ? 'expression tag' 114 8 1 2KAT HIS A 115 ? UNP Q7W6J5 ? ? 'expression tag' 115 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCACB' 1 5 1 '3D HBHA(CO)NH' 1 6 1 '3D HCCH-TOCSY' 1 7 1 '(4,3)D GFT HCCH-COSY' 1 8 1 '3D, 15N-13C RESOLVED SIMULTANIOUS NOESY' 1 9 1 '3D HNCO' 1 10 2 '2D 1H-13C HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.2 _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 278 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.3 mM [U-5% 13C; U-100% 15N] protein, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.3 mM [U-100% 13C; U-100% 15N] protein, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 750 Varian INOVA 2 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2KAT _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KAT _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KAT _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 1 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 2 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign ? 3 'Huang, Tejero, Powers and Montelione' 'structure solution' AutoStructure ? 4 'Bartels et al.' 'peak picking' XEASY ? 5 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 6 'Bhattacharya and Montelione' 'data analysis' PSVS ? 7 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KAT _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KAT _struct.title 'Solution structure of protein BPP2914 from Bordetella parapertussis. Northeast Structural Genomics Consortium target BpR206' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KAT _struct_keywords.pdbx_keywords 'structural genomics, unknown function' _struct_keywords.text 'NESG, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, unknown function' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 3 ? ALA A 13 ? ALA A 3 ALA A 13 1 ? 11 HELX_P HELX_P2 2 ASN A 18 ? HIS A 32 ? ASN A 18 HIS A 32 1 ? 15 HELX_P HELX_P3 3 GLN A 34 ? ASP A 49 ? GLN A 34 ASP A 49 1 ? 16 HELX_P HELX_P4 4 TYR A 52 ? GLY A 67 ? TYR A 52 GLY A 67 1 ? 16 HELX_P HELX_P5 5 ASP A 68 ? GLY A 87 ? ASP A 68 GLY A 87 1 ? 20 HELX_P HELX_P6 6 ASP A 88 ? HIS A 110 ? ASP A 88 HIS A 110 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2KAT _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 MET 11 11 11 MET MET A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 MET 19 19 19 MET MET A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 TRP 56 56 56 TRP TRP A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 TRP 58 58 58 TRP TRP A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 TRP 76 76 76 TRP TRP A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 HIS 110 110 110 HIS HIS A . n A 1 111 HIS 111 111 111 HIS HIS A . n A 1 112 HIS 112 112 112 HIS HIS A . n A 1 113 HIS 113 113 113 HIS HIS A . n A 1 114 HIS 114 114 114 HIS HIS A . n A 1 115 HIS 115 115 115 HIS HIS A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-12-16 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-19 4 'Structure model' 1 3 2021-10-20 5 'Structure model' 1 4 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' Other 4 4 'Structure model' 'Database references' 5 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_database_status 2 3 'Structure model' pdbx_struct_assembly 3 3 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' database_2 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 4 'Structure model' '_database_2.pdbx_DOI' 3 4 'Structure model' '_database_2.pdbx_database_accession' 4 4 'Structure model' '_struct_ref_seq_dif.details' 5 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id protein 0.3 mM '[U-5% 13C; U-100% 15N]' 1 protein 0.3 mM '[U-100% 13C; U-100% 15N]' 2 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 HH2 A TRP 56 ? ? HG3 A ARG 86 ? ? 1.27 2 3 HA A LYS 57 ? ? HD22 A LEU 95 ? ? 1.29 3 5 HH21 A ARG 73 ? ? OD1 A ASP 106 ? ? 1.59 4 7 HE21 A GLN 84 ? ? HG23 A VAL 92 ? ? 1.34 5 9 HA A LYS 57 ? ? HD23 A LEU 95 ? ? 1.28 6 9 HZ3 A LYS 57 ? ? OE1 A GLU 94 ? ? 1.60 7 10 OD2 A ASP 17 ? ? HH21 A ARG 22 ? ? 1.60 8 11 HA A LYS 57 ? ? HD21 A LEU 95 ? ? 1.22 9 11 HZ2 A LYS 57 ? ? OE2 A GLU 94 ? ? 1.60 10 12 HZ1 A LYS 57 ? ? OE1 A GLU 94 ? ? 1.57 11 13 HH11 A ARG 69 ? ? OD1 A ASP 106 ? ? 1.60 12 15 HZ3 A LYS 57 ? ? OE1 A GLU 94 ? ? 1.58 13 17 HZ1 A LYS 57 ? ? OE1 A GLU 94 ? ? 1.56 14 19 HZ3 A LYS 57 ? ? OE1 A GLU 94 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 3 ? ? 73.53 114.23 2 1 GLN A 34 ? ? -96.26 47.48 3 2 ASP A 17 ? ? -68.33 82.18 4 2 GLN A 34 ? ? -97.18 46.10 5 2 HIS A 114 ? ? 60.59 139.98 6 3 ALA A 3 ? ? 67.83 165.83 7 3 ASN A 18 ? ? -158.55 -58.96 8 3 MET A 19 ? ? -158.21 -40.73 9 3 GLU A 109 ? ? -88.71 -95.62 10 3 HIS A 111 ? ? -91.72 45.35 11 3 HIS A 113 ? ? 72.55 -82.18 12 4 ASP A 17 ? ? -72.06 -79.79 13 4 ASN A 18 ? ? 54.49 -162.95 14 4 GLN A 34 ? ? -103.94 71.67 15 4 HIS A 112 ? ? 58.40 79.42 16 4 HIS A 113 ? ? -159.95 -69.45 17 4 HIS A 114 ? ? 68.28 148.98 18 5 ALA A 3 ? ? 69.48 149.11 19 5 THR A 51 ? ? -158.17 83.41 20 5 HIS A 111 ? ? -145.19 -96.58 21 5 HIS A 112 ? ? -152.76 22.25 22 5 HIS A 113 ? ? 62.60 105.79 23 6 THR A 16 ? ? -99.77 55.47 24 6 ASP A 17 ? ? -71.76 -70.37 25 6 ASN A 18 ? ? 67.36 173.28 26 6 GLN A 34 ? ? -89.72 45.64 27 6 HIS A 111 ? ? -81.70 46.17 28 7 ALA A 3 ? ? 64.75 160.36 29 7 GLN A 34 ? ? -104.54 73.64 30 7 HIS A 112 ? ? -84.76 48.37 31 8 THR A 16 ? ? -95.41 39.64 32 8 MET A 19 ? ? -170.78 -44.72 33 8 THR A 51 ? ? -98.95 55.36 34 8 GLU A 109 ? ? -105.59 -66.29 35 9 THR A 16 ? ? -113.85 75.96 36 9 GLN A 34 ? ? -87.57 45.82 37 9 HIS A 111 ? ? -164.08 86.57 38 10 GLN A 34 ? ? -91.16 46.28 39 10 GLU A 109 ? ? -70.52 -78.17 40 10 HIS A 110 ? ? -161.35 14.35 41 11 MET A 19 ? ? -102.65 -61.39 42 11 GLN A 34 ? ? -103.43 46.74 43 12 ASN A 18 ? ? -135.04 -76.95 44 12 MET A 19 ? ? -145.40 -57.30 45 12 LEU A 21 ? ? -175.14 -33.19 46 12 GLN A 34 ? ? -98.69 45.94 47 13 ALA A 3 ? ? 64.46 156.48 48 13 GLN A 34 ? ? -97.79 45.10 49 13 GLU A 109 ? ? 65.66 -2.40 50 13 HIS A 113 ? ? -175.61 30.73 51 14 GLN A 34 ? ? -104.13 46.23 52 14 TYR A 52 ? ? -69.54 94.30 53 14 HIS A 112 ? ? 68.91 92.11 54 14 HIS A 113 ? ? -137.18 -34.35 55 15 ALA A 3 ? ? 71.20 164.51 56 15 THR A 16 ? ? -102.60 78.41 57 15 LEU A 20 ? ? -78.95 24.30 58 15 GLN A 34 ? ? -108.85 46.27 59 15 HIS A 114 ? ? 74.38 -46.40 60 16 ASN A 18 ? ? 59.93 -159.24 61 16 HIS A 114 ? ? -153.19 -28.28 62 17 LEU A 21 ? ? -175.63 -34.52 63 17 GLN A 34 ? ? -95.02 43.77 64 17 HIS A 112 ? ? -116.11 59.59 65 18 THR A 16 ? ? -96.58 45.83 66 18 ASN A 18 ? ? -147.06 -13.97 67 18 MET A 19 ? ? 73.68 -50.00 68 18 LEU A 21 ? ? -160.69 -48.63 69 18 GLN A 34 ? ? -108.00 71.94 70 18 HIS A 113 ? ? 60.83 73.57 71 19 ALA A 3 ? ? 71.63 96.63 72 19 GLN A 34 ? ? -91.86 48.46 73 19 ASP A 49 ? ? -151.05 88.73 74 20 ALA A 3 ? ? 62.18 169.45 75 20 THR A 16 ? ? -108.96 79.56 #