data_2KB6 # _entry.id 2KB6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KB6 pdb_00002kb6 10.2210/pdb2kb6/pdb RCSB RCSB100903 ? ? WWPDB D_1000100903 ? ? # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KB6 _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2008-11-21 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Weininger, U.' 1 'Schulenburg, C.' 2 'Arnold, U.' 3 'Ulbrich-Hofmann, R.' 4 'Balbach, J.' 5 # _citation.id primary _citation.title 'Impact of the C-terminal disulfide bond on the folding and stability of onconase.' _citation.journal_abbrev Chembiochem _citation.journal_volume 11 _citation.page_first 978 _citation.page_last 986 _citation.year 2010 _citation.journal_id_ASTM ? _citation.country GE _citation.journal_id_ISSN 1439-4227 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20349493 _citation.pdbx_database_id_DOI 10.1002/cbic.200900773 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Schulenburg, C.' 1 ? primary 'Weininger, U.' 2 ? primary 'Neumann, P.' 3 ? primary 'Meiselbach, H.' 4 ? primary 'Stubbs, M.T.' 5 ? primary 'Sticht, H.' 6 ? primary 'Balbach, J.' 7 ? primary 'Ulbrich-Hofmann, R.' 8 ? primary 'Arnold, U.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Protein P-30' _entity.formula_weight 11781.518 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.1.27.- _entity.pdbx_mutation 'C87A, C104A' _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name Onconase # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(PCA)DWLTFQKKHITNTRDVDCDNIMSTNLFHCKDKNTFIYSRPEPVKAICKGIIASKNVLTTSEFYLSDCNVTSRPCK YKLKKSTNKFAVTCENQAPVHFVGVGSA ; _entity_poly.pdbx_seq_one_letter_code_can ;QDWLTFQKKHITNTRDVDCDNIMSTNLFHCKDKNTFIYSRPEPVKAICKGIIASKNVLTTSEFYLSDCNVTSRPCKYKLK KSTNKFAVTCENQAPVHFVGVGSA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PCA n 1 2 ASP n 1 3 TRP n 1 4 LEU n 1 5 THR n 1 6 PHE n 1 7 GLN n 1 8 LYS n 1 9 LYS n 1 10 HIS n 1 11 ILE n 1 12 THR n 1 13 ASN n 1 14 THR n 1 15 ARG n 1 16 ASP n 1 17 VAL n 1 18 ASP n 1 19 CYS n 1 20 ASP n 1 21 ASN n 1 22 ILE n 1 23 MET n 1 24 SER n 1 25 THR n 1 26 ASN n 1 27 LEU n 1 28 PHE n 1 29 HIS n 1 30 CYS n 1 31 LYS n 1 32 ASP n 1 33 LYS n 1 34 ASN n 1 35 THR n 1 36 PHE n 1 37 ILE n 1 38 TYR n 1 39 SER n 1 40 ARG n 1 41 PRO n 1 42 GLU n 1 43 PRO n 1 44 VAL n 1 45 LYS n 1 46 ALA n 1 47 ILE n 1 48 CYS n 1 49 LYS n 1 50 GLY n 1 51 ILE n 1 52 ILE n 1 53 ALA n 1 54 SER n 1 55 LYS n 1 56 ASN n 1 57 VAL n 1 58 LEU n 1 59 THR n 1 60 THR n 1 61 SER n 1 62 GLU n 1 63 PHE n 1 64 TYR n 1 65 LEU n 1 66 SER n 1 67 ASP n 1 68 CYS n 1 69 ASN n 1 70 VAL n 1 71 THR n 1 72 SER n 1 73 ARG n 1 74 PRO n 1 75 CYS n 1 76 LYS n 1 77 TYR n 1 78 LYS n 1 79 LEU n 1 80 LYS n 1 81 LYS n 1 82 SER n 1 83 THR n 1 84 ASN n 1 85 LYS n 1 86 PHE n 1 87 ALA n 1 88 VAL n 1 89 THR n 1 90 CYS n 1 91 GLU n 1 92 ASN n 1 93 GLN n 1 94 ALA n 1 95 PRO n 1 96 VAL n 1 97 HIS n 1 98 PHE n 1 99 VAL n 1 100 GLY n 1 101 VAL n 1 102 GLY n 1 103 SER n 1 104 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Northern leopard frog' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rana pipiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 8404 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector 'pET-26b(+)' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RNP30_RANPI _struct_ref.pdbx_db_accession P22069 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QDWLTFQKKHITNTRDVDCDNIMSTNLFHCKDKNTFIYSRPEPVKAICKGIIASKNVLTTSEFYLSDCNVTSRPCKYKLK KSTNKFCVTCENQAPVHFVGVGSC ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KB6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 104 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P22069 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 104 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 104 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KB6 ALA A 87 ? UNP P22069 CYS 87 'engineered mutation' 87 1 1 2KB6 ALA A 104 ? UNP P22069 CYS 104 'engineered mutation' 104 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PCA 'L-peptide linking' n 'PYROGLUTAMIC ACID' ? 'C5 H7 N O3' 129.114 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D 1H-15N NOESY' 1 3 1 '3D 1H-15N TOCSY' 1 4 1 '2D 1H-1H NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1.0 mM [U-15N] Onconase, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2KB6 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KB6 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KB6 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal ;Linge, O'Donoghue, Nilges ; 'structure solution' ARIA ? 1 ;Linge, O'Donoghue, Nilges ; refinement ARIA ? 2 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KB6 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KB6 _struct.title 'Solution structure of onconase C87A/C104A' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KB6 _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'protein, RNase, Endonuclease, Hydrolase, Nuclease, Pyrrolidone carboxylic acid' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 2 ? HIS A 10 ? ASP A 2 HIS A 10 1 ? 9 HELX_P HELX_P2 2 ASP A 18 ? MET A 23 ? ASP A 18 MET A 23 1 ? 6 HELX_P HELX_P3 3 ARG A 40 ? ALA A 46 ? ARG A 40 ALA A 46 1 ? 7 HELX_P HELX_P4 4 ILE A 47 ? LYS A 49 ? ILE A 47 LYS A 49 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 19 SG ? ? ? 1_555 A CYS 68 SG ? ? A CYS 19 A CYS 68 1_555 ? ? ? ? ? ? ? 2.027 ? ? disulf2 disulf ? ? A CYS 30 SG ? ? ? 1_555 A CYS 75 SG ? ? A CYS 30 A CYS 75 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf3 disulf ? ? A CYS 48 SG ? ? ? 1_555 A CYS 90 SG ? ? A CYS 48 A CYS 90 1_555 ? ? ? ? ? ? ? 2.020 ? ? covale1 covale both ? A PCA 1 C ? ? ? 1_555 A ASP 2 N ? ? A PCA 1 A ASP 2 1_555 ? ? ? ? ? ? ? 1.334 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? C ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 11 ? THR A 12 ? ILE A 11 THR A 12 A 2 ILE A 37 ? TYR A 38 ? ILE A 37 TYR A 38 B 1 LYS A 33 ? THR A 35 ? LYS A 33 THR A 35 B 2 PHE A 63 ? VAL A 70 ? PHE A 63 VAL A 70 B 3 TYR A 77 ? ASN A 84 ? TYR A 77 ASN A 84 C 1 LYS A 55 ? LEU A 58 ? LYS A 55 LEU A 58 C 2 PHE A 86 ? GLU A 91 ? PHE A 86 GLU A 91 C 3 ALA A 94 ? VAL A 101 ? ALA A 94 VAL A 101 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N THR A 12 ? N THR A 12 O ILE A 37 ? O ILE A 37 B 1 2 N ASN A 34 ? N ASN A 34 O CYS A 68 ? O CYS A 68 B 2 3 N LEU A 65 ? N LEU A 65 O SER A 82 ? O SER A 82 C 1 2 N VAL A 57 ? N VAL A 57 O VAL A 88 ? O VAL A 88 C 2 3 N ALA A 87 ? N ALA A 87 O VAL A 99 ? O VAL A 99 # _atom_sites.entry_id 2KB6 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PCA 1 1 1 PCA PCA A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 TRP 3 3 3 TRP TRP A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 CYS 68 68 68 CYS CYS A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 CYS 75 75 75 CYS CYS A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 TYR 77 77 77 TYR TYR A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 CYS 90 90 90 CYS CYS A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 HIS 97 97 97 HIS HIS A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 ALA 104 104 104 ALA ALA A . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id PCA _pdbx_struct_mod_residue.label_seq_id 1 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id PCA _pdbx_struct_mod_residue.auth_seq_id 1 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id GLN _pdbx_struct_mod_residue.details 'PYROGLUTAMIC ACID' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-11-24 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 2 0 2019-12-25 4 'Structure model' 2 1 2021-11-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Experimental preparation' 6 3 'Structure model' 'Polymer sequence' 7 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' entity_poly 2 3 'Structure model' pdbx_nmr_sample_details 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_mod_residue 6 3 'Structure model' pdbx_struct_oper_list 7 3 'Structure model' struct_conn 8 3 'Structure model' struct_ref_seq_dif 9 4 'Structure model' database_2 10 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can' 2 3 'Structure model' '_pdbx_nmr_sample_details.contents' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 3 'Structure model' '_pdbx_struct_mod_residue.parent_comp_id' 5 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 6 4 'Structure model' '_database_2.pdbx_DOI' 7 4 'Structure model' '_database_2.pdbx_database_accession' 8 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_nmr_exptl_sample.component Onconase _pdbx_nmr_exptl_sample.concentration 1.0 _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-15N]' _pdbx_nmr_exptl_sample.solution_id 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 HB A THR 89 ? ? HB3 A HIS 97 ? ? 1.31 2 4 HB A THR 89 ? ? HB3 A HIS 97 ? ? 1.33 3 5 HB A THR 89 ? ? HB3 A HIS 97 ? ? 1.25 4 7 HB A THR 89 ? ? HB3 A HIS 97 ? ? 1.27 5 9 HB A THR 89 ? ? HB3 A HIS 97 ? ? 1.26 6 9 HD22 A ASN 56 ? ? HB1 A ALA 87 ? ? 1.33 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 16 ? ? -101.34 73.26 2 1 SER A 103 ? ? -171.81 -175.17 3 2 ASP A 16 ? ? -92.13 56.85 4 2 THR A 71 ? ? -101.30 -162.52 5 3 ASP A 16 ? ? -91.71 48.76 6 3 THR A 71 ? ? -112.96 -151.65 7 4 ASP A 16 ? ? -90.19 53.00 8 4 THR A 71 ? ? -110.69 -146.39 9 5 ASP A 16 ? ? -91.96 43.16 10 5 THR A 71 ? ? -94.88 -154.40 11 6 ASP A 16 ? ? -94.72 53.11 12 6 THR A 71 ? ? -108.89 -150.86 13 7 ASP A 16 ? ? -96.86 49.08 14 7 THR A 71 ? ? -105.28 -147.27 15 8 ASP A 16 ? ? -94.07 46.27 16 8 THR A 71 ? ? -107.09 -153.58 17 9 ASP A 16 ? ? -110.04 64.49 18 9 THR A 71 ? ? -105.49 -166.59 19 10 THR A 71 ? ? -103.97 -150.72 #