data_2KED # _entry.id 2KED # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KED pdb_00002ked 10.2210/pdb2ked/pdb RCSB RCSB101016 ? ? BMRB 16143 ? ? WWPDB D_1000101016 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 16143 BMRB unspecified . 2KED PDB unspecified . 2KEE PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KED _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-01-28 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Volkman, B.F.' 1 'Veldkamp, C.T.' 2 'Peterson, F.C.' 3 # _citation.id primary _citation.title 'Monomeric structure of the cardioprotective chemokine SDF-1/CXCL12' _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 18 _citation.page_first 1359 _citation.page_last 1369 _citation.year 2009 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19551879 _citation.pdbx_database_id_DOI 10.1002/pro.167 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Veldkamp, C.T.' 1 ? primary 'Ziarek, J.J.' 2 ? primary 'Su, J.' 3 ? primary 'Basnet, H.' 4 ? primary 'Lennertz, R.' 5 ? primary 'Weiner, J.J.' 6 ? primary 'Peterson, F.C.' 7 ? primary 'Baker, J.E.' 8 ? primary 'Volkman, B.F.' 9 ? # _cell.entry_id 2KED _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2KED _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Stromal cell-derived factor 1-alpha' _entity.formula_weight 8166.709 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'SDF-1, C-X-C motif chemokine 12, Pre-B cell growth-stimulating factor, PBSF, hIRH, SDF-1-alpha(3-67)' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GMKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK _entity_poly.pdbx_seq_one_letter_code_can GMKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 MET n 1 3 LYS n 1 4 PRO n 1 5 VAL n 1 6 SER n 1 7 LEU n 1 8 SER n 1 9 TYR n 1 10 ARG n 1 11 CYS n 1 12 PRO n 1 13 CYS n 1 14 ARG n 1 15 PHE n 1 16 PHE n 1 17 GLU n 1 18 SER n 1 19 HIS n 1 20 VAL n 1 21 ALA n 1 22 ARG n 1 23 ALA n 1 24 ASN n 1 25 VAL n 1 26 LYS n 1 27 HIS n 1 28 LEU n 1 29 LYS n 1 30 ILE n 1 31 LEU n 1 32 ASN n 1 33 THR n 1 34 PRO n 1 35 ASN n 1 36 CYS n 1 37 ALA n 1 38 LEU n 1 39 GLN n 1 40 ILE n 1 41 VAL n 1 42 ALA n 1 43 ARG n 1 44 LEU n 1 45 LYS n 1 46 ASN n 1 47 ASN n 1 48 ASN n 1 49 ARG n 1 50 GLN n 1 51 VAL n 1 52 CYS n 1 53 ILE n 1 54 ASP n 1 55 PRO n 1 56 LYS n 1 57 LEU n 1 58 LYS n 1 59 TRP n 1 60 ILE n 1 61 GLN n 1 62 GLU n 1 63 TYR n 1 64 LEU n 1 65 GLU n 1 66 LYS n 1 67 ALA n 1 68 LEU n 1 69 ASN n 1 70 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CXCL12, SDF1, SDF1A, SDF1B' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pQE30 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SDF1_HUMAN _struct_ref.pdbx_db_accession P48061 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK _struct_ref.pdbx_align_begin 22 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KED _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 70 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P48061 _struct_ref_seq.db_align_beg 22 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 89 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 68 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KED GLY A 1 ? UNP P48061 ? ? 'expression tag' -1 1 1 2KED MET A 2 ? UNP P48061 ? ? 'expression tag' 0 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 3 1 '3D_13C-separated_NOESY (AROMATIC)' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.001 _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1.6 mM [U-100% 13C; U-100% 15N] CXCL12/SDF1-alpha, 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker DRX' # _pdbx_nmr_refine.entry_id 2KED _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ;AUTOMATED METHODS WERE USED FOR BACKBONE CHEMICAL SHIFT ASSIGNMENT AND ITERATIVE NOE REFINEMENT. FINAL STRUCTURES WERE OBTAINED BY MOLECULAR DYNAMICS IN EXPLICIT SOLVENT, CXCL12 STRUCTURES ARE BASED ON A TOTAL OF 1221 NOE CONSTRAINTS ( 371 INTRA, 239 SEQUENTIAL, 219 MEDIUM, 392 LONG RANGE) AND 66 PHI AND PSI DIHEDRAL ANGLE CONSTRAINTS. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KED _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KED _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal SCHWIETERS,C.D.,KUSZEWSKI,J.J.,TJANDRA,N.,CLORE,G.M. refinement Xplor-NIH 2.9.3 1 Bruker collection XwinNMR 3.5 2 'Delagio,F. et al.' processing NMRPipe 2004 3 'Eccles, C., Guntert, P., Billeter, M., Wuthrich, K.' 'data analysis' XEASY 1.3 4 'C. Bartels' 'data analysis' GARANT 2.1 5 'Guntert, P.' 'structural calculation' CYANA 2.1 6 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KED _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KED _struct.title 'Structure of SDF-1/CXCL12' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KED _struct_keywords.pdbx_keywords CYTOKINE _struct_keywords.text 'stromal cell derived factor-1, SDF1-alpha, CXCL12, chemokine, Alternative splicing, Chemotaxis, Cytokine, Growth factor, Secreted' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id LEU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 57 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 70 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id LEU _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 55 _struct_conf.end_auth_comp_id LYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 68 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 36 SG ? ? A CYS 9 A CYS 34 1_555 ? ? ? ? ? ? ? 2.002 ? ? disulf2 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 52 SG ? ? A CYS 11 A CYS 50 1_555 ? ? ? ? ? ? ? 2.032 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 25 ? THR A 33 ? VAL A 23 THR A 31 A 2 ALA A 37 ? LEU A 44 ? ALA A 35 LEU A 42 A 3 GLN A 50 ? ILE A 53 ? GLN A 48 ILE A 51 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 31 ? N LEU A 29 O GLN A 39 ? O GLN A 37 A 2 3 N ALA A 42 ? N ALA A 40 O VAL A 51 ? O VAL A 49 # _atom_sites.entry_id 2KED _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 MET 2 0 ? ? ? A . n A 1 3 LYS 3 1 1 LYS LYS A . n A 1 4 PRO 4 2 2 PRO PRO A . n A 1 5 VAL 5 3 3 VAL VAL A . n A 1 6 SER 6 4 4 SER SER A . n A 1 7 LEU 7 5 5 LEU LEU A . n A 1 8 SER 8 6 6 SER SER A . n A 1 9 TYR 9 7 7 TYR TYR A . n A 1 10 ARG 10 8 8 ARG ARG A . n A 1 11 CYS 11 9 9 CYS CYS A . n A 1 12 PRO 12 10 10 PRO PRO A . n A 1 13 CYS 13 11 11 CYS CYS A . n A 1 14 ARG 14 12 12 ARG ARG A . n A 1 15 PHE 15 13 13 PHE PHE A . n A 1 16 PHE 16 14 14 PHE PHE A . n A 1 17 GLU 17 15 15 GLU GLU A . n A 1 18 SER 18 16 16 SER SER A . n A 1 19 HIS 19 17 17 HIS HIS A . n A 1 20 VAL 20 18 18 VAL VAL A . n A 1 21 ALA 21 19 19 ALA ALA A . n A 1 22 ARG 22 20 20 ARG ARG A . n A 1 23 ALA 23 21 21 ALA ALA A . n A 1 24 ASN 24 22 22 ASN ASN A . n A 1 25 VAL 25 23 23 VAL VAL A . n A 1 26 LYS 26 24 24 LYS LYS A . n A 1 27 HIS 27 25 25 HIS HIS A . n A 1 28 LEU 28 26 26 LEU LEU A . n A 1 29 LYS 29 27 27 LYS LYS A . n A 1 30 ILE 30 28 28 ILE ILE A . n A 1 31 LEU 31 29 29 LEU LEU A . n A 1 32 ASN 32 30 30 ASN ASN A . n A 1 33 THR 33 31 31 THR THR A . n A 1 34 PRO 34 32 32 PRO PRO A . n A 1 35 ASN 35 33 33 ASN ASN A . n A 1 36 CYS 36 34 34 CYS CYS A . n A 1 37 ALA 37 35 35 ALA ALA A . n A 1 38 LEU 38 36 36 LEU LEU A . n A 1 39 GLN 39 37 37 GLN GLN A . n A 1 40 ILE 40 38 38 ILE ILE A . n A 1 41 VAL 41 39 39 VAL VAL A . n A 1 42 ALA 42 40 40 ALA ALA A . n A 1 43 ARG 43 41 41 ARG ARG A . n A 1 44 LEU 44 42 42 LEU LEU A . n A 1 45 LYS 45 43 43 LYS LYS A . n A 1 46 ASN 46 44 44 ASN ASN A . n A 1 47 ASN 47 45 45 ASN ASN A . n A 1 48 ASN 48 46 46 ASN ASN A . n A 1 49 ARG 49 47 47 ARG ARG A . n A 1 50 GLN 50 48 48 GLN GLN A . n A 1 51 VAL 51 49 49 VAL VAL A . n A 1 52 CYS 52 50 50 CYS CYS A . n A 1 53 ILE 53 51 51 ILE ILE A . n A 1 54 ASP 54 52 52 ASP ASP A . n A 1 55 PRO 55 53 53 PRO PRO A . n A 1 56 LYS 56 54 54 LYS LYS A . n A 1 57 LEU 57 55 55 LEU LEU A . n A 1 58 LYS 58 56 56 LYS LYS A . n A 1 59 TRP 59 57 57 TRP TRP A . n A 1 60 ILE 60 58 58 ILE ILE A . n A 1 61 GLN 61 59 59 GLN GLN A . n A 1 62 GLU 62 60 60 GLU GLU A . n A 1 63 TYR 63 61 61 TYR TYR A . n A 1 64 LEU 64 62 62 LEU LEU A . n A 1 65 GLU 65 63 63 GLU GLU A . n A 1 66 LYS 66 64 64 LYS LYS A . n A 1 67 ALA 67 65 65 ALA ALA A . n A 1 68 LEU 68 66 66 LEU LEU A . n A 1 69 ASN 69 67 67 ASN ASN A . n A 1 70 LYS 70 68 68 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-09-29 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-19 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other 6 4 'Structure model' 'Database references' 7 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_database_status 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_struct_ref_seq_dif.details' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' 6 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_nmr_exptl_sample.component CXCL12/SDF1-alpha-1 _pdbx_nmr_exptl_sample.concentration 1.6 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-100% 13C; U-100% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 H _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 15 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 CYS _pdbx_validate_close_contact.auth_seq_id_2 50 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 3 ? ? 66.91 73.94 2 1 SER A 4 ? ? -174.37 114.91 3 1 SER A 6 ? ? 53.82 73.00 4 1 HIS A 17 ? ? 61.07 81.43 5 1 PRO A 32 ? ? -27.84 -60.14 6 1 ALA A 35 ? ? 68.03 -166.41 7 1 LYS A 43 ? ? -72.38 -71.54 8 1 ASN A 46 ? ? 59.73 17.85 9 1 LYS A 64 ? ? -58.56 -70.18 10 2 ALA A 35 ? ? 62.54 -167.76 11 2 LYS A 64 ? ? -58.03 -71.05 12 3 VAL A 3 ? ? 69.10 -75.56 13 3 PRO A 32 ? ? -28.15 -29.18 14 3 ASN A 33 ? ? -162.64 28.71 15 3 ALA A 35 ? ? 174.24 179.47 16 3 LYS A 43 ? ? -70.91 -71.63 17 4 SER A 4 ? ? -84.75 31.26 18 4 ASN A 33 ? ? -130.98 -38.74 19 4 ALA A 35 ? ? 65.72 -164.63 20 5 ALA A 35 ? ? 67.62 -167.30 21 6 PRO A 32 ? ? -29.46 -60.35 22 6 ALA A 35 ? ? 67.43 -92.10 23 6 LYS A 64 ? ? -53.91 -71.25 24 7 ARG A 12 ? ? -130.65 -32.66 25 7 ALA A 35 ? ? 64.02 -163.45 26 8 LEU A 5 ? ? -156.84 80.98 27 8 PRO A 32 ? ? -55.28 2.99 28 8 CYS A 34 ? ? -133.29 -73.60 29 8 ALA A 35 ? ? 163.92 -172.13 30 8 ASN A 46 ? ? 70.05 -5.27 31 9 PRO A 32 ? ? -42.43 -16.98 32 9 ASN A 33 ? ? -146.96 10.31 33 9 ALA A 35 ? ? 67.92 -168.53 34 10 TYR A 7 ? ? -98.86 -63.03 35 10 PRO A 32 ? ? -74.68 25.20 36 10 CYS A 34 ? ? -136.03 -69.92 37 10 ALA A 35 ? ? 165.94 -177.42 38 11 SER A 4 ? ? 58.61 80.16 39 11 ASN A 33 ? ? 77.26 -14.37 40 11 ALA A 35 ? ? 67.56 -173.63 41 11 PRO A 53 ? ? -68.76 2.25 42 12 SER A 6 ? ? 68.09 172.46 43 12 ALA A 35 ? ? 69.29 -169.42 44 12 ASN A 46 ? ? 66.35 -6.65 45 13 LEU A 5 ? ? 66.86 107.87 46 13 PRO A 32 ? ? -27.69 -61.93 47 13 ALA A 35 ? ? 69.06 -167.19 48 14 SER A 4 ? ? 74.11 78.62 49 14 SER A 6 ? ? 61.96 -167.30 50 14 HIS A 17 ? ? -154.89 88.31 51 14 PRO A 32 ? ? -29.03 -51.97 52 14 ALA A 35 ? ? 66.16 -167.35 53 14 ASN A 46 ? ? 70.12 -0.81 54 15 ALA A 35 ? ? 70.45 -163.65 55 15 ASN A 46 ? ? 62.59 -0.67 56 16 PRO A 2 ? ? -69.30 90.79 57 16 VAL A 3 ? ? -174.82 116.98 58 16 PRO A 32 ? ? -29.62 -40.02 59 16 ASN A 33 ? ? -141.96 12.44 60 16 ALA A 35 ? ? 63.28 -167.76 61 16 ASN A 46 ? ? 66.01 -9.92 62 16 LYS A 64 ? ? -60.74 -70.05 63 17 LEU A 5 ? ? -169.24 61.99 64 17 ALA A 35 ? ? 68.15 -163.83 65 18 PRO A 32 ? ? -39.28 -31.95 66 18 ALA A 35 ? ? 68.13 -161.37 67 18 LYS A 64 ? ? -57.56 -70.76 68 19 ALA A 35 ? ? 69.75 -171.48 69 20 VAL A 3 ? ? -160.58 -38.02 70 20 PRO A 32 ? ? -62.06 19.03 71 20 ASN A 33 ? ? -174.82 -32.99 72 20 CYS A 34 ? ? -71.10 -75.17 73 20 ALA A 35 ? ? 176.11 -169.12 74 20 ASN A 46 ? ? 67.14 -8.06 75 20 LYS A 64 ? ? -61.99 -73.84 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A MET 0 ? A MET 2 3 2 Y 1 A GLY -1 ? A GLY 1 4 2 Y 1 A MET 0 ? A MET 2 5 3 Y 1 A GLY -1 ? A GLY 1 6 3 Y 1 A MET 0 ? A MET 2 7 4 Y 1 A GLY -1 ? A GLY 1 8 4 Y 1 A MET 0 ? A MET 2 9 5 Y 1 A GLY -1 ? A GLY 1 10 5 Y 1 A MET 0 ? A MET 2 11 6 Y 1 A GLY -1 ? A GLY 1 12 6 Y 1 A MET 0 ? A MET 2 13 7 Y 1 A GLY -1 ? A GLY 1 14 7 Y 1 A MET 0 ? A MET 2 15 8 Y 1 A GLY -1 ? A GLY 1 16 8 Y 1 A MET 0 ? A MET 2 17 9 Y 1 A GLY -1 ? A GLY 1 18 9 Y 1 A MET 0 ? A MET 2 19 10 Y 1 A GLY -1 ? A GLY 1 20 10 Y 1 A MET 0 ? A MET 2 21 11 Y 1 A GLY -1 ? A GLY 1 22 11 Y 1 A MET 0 ? A MET 2 23 12 Y 1 A GLY -1 ? A GLY 1 24 12 Y 1 A MET 0 ? A MET 2 25 13 Y 1 A GLY -1 ? A GLY 1 26 13 Y 1 A MET 0 ? A MET 2 27 14 Y 1 A GLY -1 ? A GLY 1 28 14 Y 1 A MET 0 ? A MET 2 29 15 Y 1 A GLY -1 ? A GLY 1 30 15 Y 1 A MET 0 ? A MET 2 31 16 Y 1 A GLY -1 ? A GLY 1 32 16 Y 1 A MET 0 ? A MET 2 33 17 Y 1 A GLY -1 ? A GLY 1 34 17 Y 1 A MET 0 ? A MET 2 35 18 Y 1 A GLY -1 ? A GLY 1 36 18 Y 1 A MET 0 ? A MET 2 37 19 Y 1 A GLY -1 ? A GLY 1 38 19 Y 1 A MET 0 ? A MET 2 39 20 Y 1 A GLY -1 ? A GLY 1 40 20 Y 1 A MET 0 ? A MET 2 #