data_2KES # _entry.id 2KES # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KES pdb_00002kes 10.2210/pdb2kes/pdb RCSB RCSB101031 ? ? WWPDB D_1000101031 ? ? # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KES _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2009-02-02 _pdbx_database_status.SG_entry . _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Xie, Y.Y.' 1 ? 'Zhou, C.J.' 2 ? 'Zhou, Z.R.' 3 ? 'Hu, H.Y.' 4 ? # _citation.id primary _citation.title 'Interaction with synphilin-1 promotes inclusion formation of alpha-synuclein: mechanistic insights and pathological implication.' _citation.journal_abbrev 'Faseb J.' _citation.journal_volume 24 _citation.page_first 196 _citation.page_last 205 _citation.year 2010 _citation.journal_id_ASTM FAJOEC _citation.country US _citation.journal_id_ISSN 0892-6638 _citation.journal_id_CSD 2074 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19762560 _citation.pdbx_database_id_DOI 10.1096/fj.09-133082 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xie, Y.Y.' 1 ? primary 'Zhou, C.J.' 2 ? primary 'Zhou, Z.R.' 3 ? primary 'Hong, J.' 4 ? primary 'Che, M.X.' 5 ? primary 'Fu, Q.S.' 6 ? primary 'Song, A.X.' 7 ? primary 'Lin, D.H.' 8 ? primary 'Hu, H.Y.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Synphilin-1 _entity.formula_weight 5371.143 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Coiled-coil Domain, residues 512-557' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Alpha-synuclein-interacting protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSVETCMSLASQVVKLTKQLKEQTVERVTLQNQLQQFLEAQKSEGKSL _entity_poly.pdbx_seq_one_letter_code_can GSVETCMSLASQVVKLTKQLKEQTVERVTLQNQLQQFLEAQKSEGKSL _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 VAL n 1 4 GLU n 1 5 THR n 1 6 CYS n 1 7 MET n 1 8 SER n 1 9 LEU n 1 10 ALA n 1 11 SER n 1 12 GLN n 1 13 VAL n 1 14 VAL n 1 15 LYS n 1 16 LEU n 1 17 THR n 1 18 LYS n 1 19 GLN n 1 20 LEU n 1 21 LYS n 1 22 GLU n 1 23 GLN n 1 24 THR n 1 25 VAL n 1 26 GLU n 1 27 ARG n 1 28 VAL n 1 29 THR n 1 30 LEU n 1 31 GLN n 1 32 ASN n 1 33 GLN n 1 34 LEU n 1 35 GLN n 1 36 GLN n 1 37 PHE n 1 38 LEU n 1 39 GLU n 1 40 ALA n 1 41 GLN n 1 42 LYS n 1 43 SER n 1 44 GLU n 1 45 GLY n 1 46 LYS n 1 47 SER n 1 48 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene SNCAIP _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET-32M _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SNCAP_HUMAN _struct_ref.pdbx_db_accession Q9Y6H5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code VETCMSLASQVVKLTKQLKEQTVERVTLQNQLQQFLEAQKSEGKSL _struct_ref.pdbx_align_begin 512 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KES _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 48 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9Y6H5 _struct_ref_seq.db_align_beg 512 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 557 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 512 _struct_ref_seq.pdbx_auth_seq_align_end 557 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KES GLY A 1 ? UNP Q9Y6H5 ? ? 'expression tag' 510 1 1 2KES SER A 2 ? UNP Q9Y6H5 ? ? 'expression tag' 511 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '3D HNHA' 1 3 2 '3D 1H-15N NOESY' 1 4 3 '3D HNCACB' 1 5 3 '3D CBCA(CO)NH' 1 6 3 '3D HBHA(CO)NH' 1 7 3 '3D HNCO' 1 8 3 '3D HCCH-TOCSY' 1 9 3 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.2mM [U-15N] Synphilin-1, 20mM sodium phosphate, 50mM sodium chloride, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1mM [U-100% 15N] Synphilin-1, 20mM sodium phosphate, 50mM sodium chloride, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' '1mM [U-13C; U-15N] Synphilin-1, 20mM sodium phosphate, 50mM sodium chloride, 90% H2O/10% D2O' 3 '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker DRX' # _pdbx_nmr_refine.entry_id 2KES _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KES _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KES _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe . 1 Goddard 'peak picking' Sparky . 2 Goddard 'chemical shift assignment' Sparky . 3 ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA . 4 ;Linge, O'Donoghue and Nilges ; refinement ARIA . 5 'Laskowski and MacArthur' 'data analysis' ProcheckNMR . 6 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KES _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KES _struct.title 'Solution Structure of the Coiled-coil Domain of Synphilin-1' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KES _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text ;Synphillin, coiled-coil, ANK repeat, Disease mutation, Parkinson disease, Phosphoprotein, Polymorphism, Ubl conjugation, PROTEIN BINDING ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 2 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 46 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 511 _struct_conf.end_auth_comp_id LYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 555 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 45 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2KES _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 510 510 GLY GLY A . n A 1 2 SER 2 511 511 SER SER A . n A 1 3 VAL 3 512 512 VAL VAL A . n A 1 4 GLU 4 513 513 GLU GLU A . n A 1 5 THR 5 514 514 THR THR A . n A 1 6 CYS 6 515 515 CYS CYS A . n A 1 7 MET 7 516 516 MET MET A . n A 1 8 SER 8 517 517 SER SER A . n A 1 9 LEU 9 518 518 LEU LEU A . n A 1 10 ALA 10 519 519 ALA ALA A . n A 1 11 SER 11 520 520 SER SER A . n A 1 12 GLN 12 521 521 GLN GLN A . n A 1 13 VAL 13 522 522 VAL VAL A . n A 1 14 VAL 14 523 523 VAL VAL A . n A 1 15 LYS 15 524 524 LYS LYS A . n A 1 16 LEU 16 525 525 LEU LEU A . n A 1 17 THR 17 526 526 THR THR A . n A 1 18 LYS 18 527 527 LYS LYS A . n A 1 19 GLN 19 528 528 GLN GLN A . n A 1 20 LEU 20 529 529 LEU LEU A . n A 1 21 LYS 21 530 530 LYS LYS A . n A 1 22 GLU 22 531 531 GLU GLU A . n A 1 23 GLN 23 532 532 GLN GLN A . n A 1 24 THR 24 533 533 THR THR A . n A 1 25 VAL 25 534 534 VAL VAL A . n A 1 26 GLU 26 535 535 GLU GLU A . n A 1 27 ARG 27 536 536 ARG ARG A . n A 1 28 VAL 28 537 537 VAL VAL A . n A 1 29 THR 29 538 538 THR THR A . n A 1 30 LEU 30 539 539 LEU LEU A . n A 1 31 GLN 31 540 540 GLN GLN A . n A 1 32 ASN 32 541 541 ASN ASN A . n A 1 33 GLN 33 542 542 GLN GLN A . n A 1 34 LEU 34 543 543 LEU LEU A . n A 1 35 GLN 35 544 544 GLN GLN A . n A 1 36 GLN 36 545 545 GLN GLN A . n A 1 37 PHE 37 546 546 PHE PHE A . n A 1 38 LEU 38 547 547 LEU LEU A . n A 1 39 GLU 39 548 548 GLU GLU A . n A 1 40 ALA 40 549 549 ALA ALA A . n A 1 41 GLN 41 550 550 GLN GLN A . n A 1 42 LYS 42 551 551 LYS LYS A . n A 1 43 SER 43 552 552 SER SER A . n A 1 44 GLU 44 553 553 GLU GLU A . n A 1 45 GLY 45 554 554 GLY GLY A . n A 1 46 LYS 46 555 555 LYS LYS A . n A 1 47 SER 47 556 556 SER SER A . n A 1 48 LEU 48 557 557 LEU LEU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-02-24 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id Synphilin-1 0.2 ? mM '[U-15N]' 1 'sodium phosphate' 20 ? mM ? 1 'sodium chloride' 50 ? mM ? 1 Synphilin-1 1 ? mM '[U-100% 15N]' 2 'sodium phosphate' 20 ? mM ? 2 'sodium chloride' 50 ? mM ? 2 Synphilin-1 1 ? mM '[U-13C; U-15N]' 3 'sodium phosphate' 20 ? mM ? 3 'sodium chloride' 50 ? mM ? 3 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2KES _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 565 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 308 _pdbx_nmr_constraints.NOE_long_range_total_count 0 _pdbx_nmr_constraints.NOE_medium_range_total_count 107 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 150 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 H2 A GLY 510 ? ? OE2 A GLU 513 ? ? 1.55 2 11 HA A LEU 547 ? ? HE21 A GLN 550 ? ? 1.31 3 15 HA A LEU 547 ? ? HE21 A GLN 550 ? ? 1.33 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 511 ? ? 73.10 -28.92 2 2 SER A 511 ? ? -153.72 84.75 3 3 SER A 511 ? ? -92.36 -65.96 4 8 SER A 511 ? ? 69.39 -58.85 5 10 SER A 511 ? ? -91.21 31.48 6 10 VAL A 512 ? ? 70.99 -54.44 7 11 CYS A 515 ? ? 72.18 -38.86 #