data_2KM0 # _entry.id 2KM0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KM0 pdb_00002km0 10.2210/pdb2km0/pdb RCSB RCSB101287 ? ? WWPDB D_1000101287 ? ? BMRB 16408 ? 10.13018/BMR16408 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-03-16 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-26 4 'Structure model' 1 3 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Database references' 8 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' database_2 9 4 'Structure model' pdbx_struct_conn_angle 10 4 'Structure model' struct_conn 11 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_spectrometer.model' 3 4 'Structure model' '_database_2.pdbx_DOI' 4 4 'Structure model' '_database_2.pdbx_database_accession' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.value' 10 4 'Structure model' '_struct_conn.pdbx_dist_value' 11 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 12 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 13 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 14 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 15 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KM0 _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2009-07-15 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 2K0Q PDB 'apo-CopK protein, solution structure' unspecified 16408 BMRB . # _audit_author.name 'Bersch, B.' _audit_author.pdbx_ordinal 1 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;CopK from Cupriavidus metallidurans CH34 Binds Cu(I) in a Tetrathioether Site: Characterization by X-ray Absorption and NMR Spectroscopy ; J.Am.Chem.Soc. ? ? ? 2010 JACSAT US 1520-5126 ? ? 20192263 10.1021/ja9083896 1 ;Molecular structure and metal-binding properties of the periplasmic CopK protein expressed in Cupriavidus metallidurans CH34 during copper challenge ; J.Mol.Biol. 380 386 403 2008 JMOBAK UK 0022-2836 0070 ? 18533181 10.1016/j.jmb.2008.05.017 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sarret, G.' 1 ? primary 'Favier, A.' 2 ? primary 'Hazemann, J.L.' 3 ? primary 'Mergeay, M.' 4 ? primary 'Bersch, B.' 5 ? 1 'Bersch, B.' 6 ? 1 'Favier, A.' 7 ? 1 'Schanda, P.' 8 ? 1 'van Aelst, S.' 9 ? 1 'Vallaeys, T.' 10 ? 1 'Coves, J.' 11 ? 1 'Mergeay, M.' 12 ? 1 'Wattiez, R.' 13 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Copper resistance protein K' 8294.567 1 ? ? ? ? 2 non-polymer syn 'COPPER (I) ION' 63.546 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code VDMSNVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLDEALRKGHSEGG _entity_poly.pdbx_seq_one_letter_code_can VDMSNVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLDEALRKGHSEGG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'COPPER (I) ION' _pdbx_entity_nonpoly.comp_id CU1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 ASP n 1 3 MET n 1 4 SER n 1 5 ASN n 1 6 VAL n 1 7 VAL n 1 8 LYS n 1 9 THR n 1 10 TYR n 1 11 ASP n 1 12 LEU n 1 13 GLN n 1 14 ASP n 1 15 GLY n 1 16 SER n 1 17 LYS n 1 18 VAL n 1 19 HIS n 1 20 VAL n 1 21 PHE n 1 22 LYS n 1 23 ASP n 1 24 GLY n 1 25 LYS n 1 26 MET n 1 27 GLY n 1 28 MET n 1 29 GLU n 1 30 ASN n 1 31 LYS n 1 32 PHE n 1 33 GLY n 1 34 LYS n 1 35 SER n 1 36 MET n 1 37 ASN n 1 38 MET n 1 39 PRO n 1 40 GLU n 1 41 GLY n 1 42 LYS n 1 43 VAL n 1 44 MET n 1 45 GLU n 1 46 THR n 1 47 ARG n 1 48 ASP n 1 49 GLY n 1 50 THR n 1 51 LYS n 1 52 ILE n 1 53 ILE n 1 54 MET n 1 55 LYS n 1 56 GLY n 1 57 ASN n 1 58 GLU n 1 59 ILE n 1 60 PHE n 1 61 ARG n 1 62 LEU n 1 63 ASP n 1 64 GLU n 1 65 ALA n 1 66 LEU n 1 67 ARG n 1 68 LYS n 1 69 GLY n 1 70 HIS n 1 71 SER n 1 72 GLU n 1 73 GLY n 1 74 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain CH34 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Ralstonia metallidurans' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 266264 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET30 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU1 non-polymer . 'COPPER (I) ION' ? 'Cu 1' 63.546 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 1 VAL VAL A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 MET 28 28 28 MET MET A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 MET 36 36 36 MET MET A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 MET 38 38 38 MET MET A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 MET 54 54 54 MET MET A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 GLY 74 74 74 GLY GLY A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id CU1 _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 75 _pdbx_nonpoly_scheme.auth_seq_num 75 _pdbx_nonpoly_scheme.pdb_mon_id CU1 _pdbx_nonpoly_scheme.auth_mon_id CU1 _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'CopK protein bound to a single Cu(I)' _exptl.entry_id 2KM0 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KM0 _struct.title 'Cu(I)-bound CopK' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KM0 _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'heavy metal resistance, periplasmic copper binding protein, Copper, Periplasm, Plasmid, METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code COPK_RALME _struct_ref.pdbx_db_accession Q58AD3 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code VDMSNVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLDEALRKGHSEGG _struct_ref.pdbx_align_begin 21 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KM0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 74 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q58AD3 _struct_ref_seq.db_align_beg 21 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 94 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 74 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id LEU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 62 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ARG _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 67 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id LEU _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 62 _struct_conf.end_auth_comp_id ARG _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 67 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A MET 28 SD ? ? ? 1_555 B CU1 . CU ? ? A MET 28 A CU1 75 1_555 ? ? ? ? ? ? ? 2.314 ? ? metalc2 metalc ? ? A MET 38 SD ? ? ? 1_555 B CU1 . CU ? ? A MET 38 A CU1 75 1_555 ? ? ? ? ? ? ? 2.297 ? ? metalc3 metalc ? ? A MET 44 SD ? ? ? 1_555 B CU1 . CU ? ? A MET 44 A CU1 75 1_555 ? ? ? ? ? ? ? 2.290 ? ? metalc4 metalc ? ? A MET 54 SD ? ? ? 1_555 B CU1 . CU ? ? A MET 54 A CU1 75 1_555 ? ? ? ? ? ? ? 2.310 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SD ? A MET 28 ? A MET 28 ? 1_555 CU ? B CU1 . ? A CU1 75 ? 1_555 SD ? A MET 38 ? A MET 38 ? 1_555 108.4 ? 2 SD ? A MET 28 ? A MET 28 ? 1_555 CU ? B CU1 . ? A CU1 75 ? 1_555 SD ? A MET 44 ? A MET 44 ? 1_555 109.4 ? 3 SD ? A MET 38 ? A MET 38 ? 1_555 CU ? B CU1 . ? A CU1 75 ? 1_555 SD ? A MET 44 ? A MET 44 ? 1_555 106.1 ? 4 SD ? A MET 28 ? A MET 28 ? 1_555 CU ? B CU1 . ? A CU1 75 ? 1_555 SD ? A MET 54 ? A MET 54 ? 1_555 115.3 ? 5 SD ? A MET 38 ? A MET 38 ? 1_555 CU ? B CU1 . ? A CU1 75 ? 1_555 SD ? A MET 54 ? A MET 54 ? 1_555 111.0 ? 6 SD ? A MET 44 ? A MET 44 ? 1_555 CU ? B CU1 . ? A CU1 75 ? 1_555 SD ? A MET 54 ? A MET 54 ? 1_555 106.2 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 6 ? ASP A 11 ? VAL A 6 ASP A 11 A 2 SER A 16 ? PHE A 21 ? SER A 16 PHE A 21 A 3 MET A 26 ? ASN A 30 ? MET A 26 ASN A 30 B 1 VAL A 43 ? GLU A 45 ? VAL A 43 GLU A 45 B 2 LYS A 51 ? ILE A 53 ? LYS A 51 ILE A 53 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 8 ? N LYS A 8 O VAL A 20 ? O VAL A 20 A 2 3 N HIS A 19 ? N HIS A 19 O GLY A 27 ? O GLY A 27 B 1 2 N MET A 44 ? N MET A 44 O ILE A 52 ? O ILE A 52 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CU1 _struct_site.pdbx_auth_seq_id 75 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE CU1 A 75' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 MET A 28 ? MET A 28 . ? 1_555 ? 2 AC1 4 MET A 38 ? MET A 38 . ? 1_555 ? 3 AC1 4 MET A 44 ? MET A 44 . ? 1_555 ? 4 AC1 4 MET A 54 ? MET A 54 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HE2 A MET 3 ? ? HG11 A VAL 6 ? ? 1.31 2 2 OE1 A GLU 64 ? ? HD1 A HIS 70 ? ? 1.58 3 2 OE1 A GLU 45 ? ? HZ2 A LYS 51 ? ? 1.59 4 3 HG11 A VAL 20 ? ? HG2 A MET 26 ? ? 1.15 5 3 HE2 A HIS 19 ? ? OE1 A GLU 29 ? ? 1.58 6 3 OE2 A GLU 40 ? ? HZ1 A LYS 55 ? ? 1.60 7 4 HB3 A LEU 62 ? ? H A ASP 63 ? ? 1.26 8 5 HB2 A MET 28 ? ? HE2 A MET 54 ? ? 1.23 9 5 HB3 A LEU 62 ? ? H A ASP 63 ? ? 1.28 10 5 HD1 A HIS 70 ? ? OE2 A GLU 72 ? ? 1.57 11 5 OE2 A GLU 45 ? ? HZ2 A LYS 51 ? ? 1.59 12 6 OD1 A ASP 63 ? ? HZ3 A LYS 68 ? ? 1.54 13 7 OE2 A GLU 64 ? ? HZ3 A LYS 68 ? ? 1.60 14 8 OD2 A ASP 23 ? ? HZ1 A LYS 25 ? ? 1.59 15 9 HG11 A VAL 20 ? ? HG2 A MET 26 ? ? 1.20 16 9 OE2 A GLU 45 ? ? HZ1 A LYS 51 ? ? 1.57 17 10 HG13 A VAL 20 ? ? HG2 A MET 26 ? ? 1.27 18 11 HG12 A VAL 20 ? ? HG2 A MET 26 ? ? 1.18 19 12 HG12 A VAL 20 ? ? HG2 A MET 26 ? ? 1.28 20 13 HB3 A ASP 11 ? ? HE A ARG 47 ? ? 1.06 21 13 H A MET 26 ? ? OE2 A GLU 58 ? ? 1.57 22 13 H2 A VAL 1 ? ? OE1 A GLU 64 ? ? 1.58 23 15 HB A VAL 1 ? ? HD12 A LEU 62 ? ? 1.31 24 15 HD21 A ASN 57 ? ? HG3 A GLU 58 ? ? 1.34 25 15 OD2 A ASP 48 ? ? HG1 A THR 50 ? ? 1.56 26 17 HG11 A VAL 20 ? ? HG2 A MET 26 ? ? 1.17 27 18 HG13 A VAL 20 ? ? HG2 A MET 26 ? ? 1.23 28 18 HD22 A ASN 30 ? ? HB2 A LYS 34 ? ? 1.24 29 20 HG12 A VAL 20 ? ? HG2 A MET 26 ? ? 1.17 30 20 HD1 A HIS 70 ? ? OE1 A GLU 72 ? ? 1.60 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 2 CE1 A TYR 10 ? ? CZ A TYR 10 ? ? 1.477 1.381 0.096 0.013 N 2 2 CZ A TYR 10 ? ? CE2 A TYR 10 ? ? 1.285 1.381 -0.096 0.013 N 3 9 CZ A TYR 10 ? ? CE2 A TYR 10 ? ? 1.299 1.381 -0.082 0.013 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 61 ? ? -69.14 88.36 2 1 LEU A 62 ? ? -178.94 -52.22 3 1 LYS A 68 ? ? -157.75 -146.23 4 1 HIS A 70 ? ? -159.39 -81.57 5 1 SER A 71 ? ? -87.81 -78.89 6 1 GLU A 72 ? ? 57.56 83.80 7 2 SER A 35 ? ? -42.64 95.53 8 2 ARG A 61 ? ? 59.24 -170.47 9 2 ARG A 67 ? ? -77.95 -76.18 10 2 LYS A 68 ? ? -144.23 22.42 11 3 PRO A 39 ? ? -83.53 -156.94 12 3 ILE A 59 ? ? 67.12 178.14 13 3 ARG A 61 ? ? 55.15 16.70 14 3 LEU A 66 ? ? -102.03 -60.74 15 4 VAL A 43 ? ? -68.36 99.83 16 4 ARG A 61 ? ? 70.74 -126.94 17 4 LEU A 62 ? ? -97.88 -139.24 18 4 LYS A 68 ? ? 58.30 -104.36 19 5 SER A 35 ? ? -56.56 104.75 20 5 GLU A 58 ? ? -167.25 101.12 21 5 ARG A 61 ? ? 65.14 -149.22 22 5 LEU A 62 ? ? -77.08 -115.25 23 5 ASP A 63 ? ? -166.46 -71.51 24 5 LYS A 68 ? ? 62.23 93.84 25 6 ASN A 5 ? ? -147.33 16.61 26 6 LYS A 31 ? ? -56.45 -9.33 27 6 LYS A 55 ? ? -138.50 -92.86 28 6 ARG A 61 ? ? 64.80 174.89 29 6 LEU A 62 ? ? -116.59 -95.52 30 7 PRO A 39 ? ? -75.81 -166.87 31 7 ILE A 59 ? ? 55.36 169.73 32 7 ARG A 61 ? ? 36.62 75.74 33 7 LEU A 62 ? ? -121.53 -97.55 34 7 ASP A 63 ? ? -151.25 -72.55 35 8 ARG A 61 ? ? 70.91 -85.68 36 8 LEU A 62 ? ? -148.81 -53.15 37 8 ASP A 63 ? ? 73.68 -29.35 38 9 SER A 35 ? ? -33.06 92.54 39 9 ARG A 61 ? ? 55.08 -84.85 40 9 LEU A 62 ? ? 70.91 -74.42 41 9 ASP A 63 ? ? 179.96 -32.98 42 9 LYS A 68 ? ? -84.28 -72.32 43 9 HIS A 70 ? ? -155.32 -68.82 44 9 SER A 71 ? ? -140.74 -69.32 45 10 MET A 54 ? ? -81.70 35.46 46 10 ARG A 61 ? ? 63.42 -167.29 47 10 ARG A 67 ? ? -106.13 -73.06 48 10 HIS A 70 ? ? 67.21 93.12 49 10 SER A 71 ? ? -95.50 -74.27 50 11 SER A 35 ? ? -58.89 99.40 51 11 LYS A 55 ? ? -140.40 -138.24 52 11 GLU A 58 ? ? -130.57 -67.86 53 11 ILE A 59 ? ? 75.01 -68.55 54 11 ARG A 61 ? ? 70.82 -88.43 55 11 LEU A 62 ? ? -175.28 131.60 56 12 MET A 3 ? ? 56.37 10.52 57 12 SER A 35 ? ? -58.07 108.56 58 12 MET A 54 ? ? -75.81 47.92 59 12 GLU A 58 ? ? -152.84 75.43 60 12 ARG A 61 ? ? 45.55 -106.65 61 13 SER A 35 ? ? -57.77 108.47 62 13 PRO A 39 ? ? -84.67 -155.84 63 13 GLU A 58 ? ? -163.08 108.11 64 13 ILE A 59 ? ? -83.03 -91.20 65 13 PHE A 60 ? ? -107.39 -66.37 66 13 ARG A 61 ? ? 49.83 29.40 67 13 LEU A 62 ? ? -145.56 37.77 68 13 ARG A 67 ? ? -77.50 -71.09 69 13 LYS A 68 ? ? 68.56 -48.84 70 13 GLU A 72 ? ? 61.62 88.08 71 14 SER A 35 ? ? -52.75 106.44 72 14 LYS A 55 ? ? -146.10 -149.79 73 14 ILE A 59 ? ? 71.96 -86.23 74 14 ARG A 61 ? ? 73.03 -86.14 75 14 LEU A 62 ? ? -120.91 -75.53 76 14 ASP A 63 ? ? 70.87 -46.73 77 14 ARG A 67 ? ? 54.95 78.65 78 15 SER A 35 ? ? -49.87 109.21 79 15 ILE A 59 ? ? -85.68 -157.93 80 15 ARG A 61 ? ? 64.30 -31.26 81 15 ARG A 67 ? ? -77.48 -76.28 82 15 LYS A 68 ? ? 66.04 116.06 83 15 HIS A 70 ? ? 69.40 112.36 84 15 GLU A 72 ? ? 71.63 -59.52 85 16 GLU A 58 ? ? -107.55 57.28 86 16 ARG A 61 ? ? 61.64 -82.22 87 16 LEU A 62 ? ? 54.15 91.36 88 16 HIS A 70 ? ? -172.92 17.94 89 17 MET A 3 ? ? 56.80 14.64 90 17 LYS A 55 ? ? -132.95 -155.40 91 17 ARG A 61 ? ? 64.29 -108.07 92 17 LYS A 68 ? ? 74.43 -36.28 93 17 HIS A 70 ? ? -173.44 140.67 94 18 ARG A 61 ? ? 71.86 -97.58 95 18 ARG A 67 ? ? -48.72 -79.86 96 18 LYS A 68 ? ? 63.47 -71.45 97 18 SER A 71 ? ? 67.78 -85.75 98 19 SER A 35 ? ? -56.78 106.53 99 19 MET A 54 ? ? -60.07 98.01 100 19 ARG A 61 ? ? 67.56 -143.09 101 19 LEU A 62 ? ? -109.36 -64.74 102 19 ASP A 63 ? ? -162.18 -35.50 103 19 LYS A 68 ? ? 71.45 -51.21 104 19 HIS A 70 ? ? 68.57 100.14 105 19 SER A 71 ? ? -102.83 -169.11 106 20 SER A 35 ? ? -36.02 95.74 107 20 GLU A 58 ? ? -152.59 55.01 108 20 ILE A 59 ? ? -74.76 -165.26 109 20 ARG A 61 ? ? 64.90 -23.38 110 20 GLU A 72 ? ? 66.61 123.50 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 1000 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KM0 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KM0 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM [U-100% 15N] CopK-1, 0.95 mM COPPER(I) ION-2, 50 mM ammonium acetate-3, 10 mM sodium ascorbate-4, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1.6 mM [U-100% 13C; U-100% 15N] CopK-5, 1.5 mM COPPER(I) ION-6, 50 mM ammonium acetate-7, 16 mM sodium ascorbate-8, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' '1.5 mM CopK-9, 1.4 mM COPPER(I) ION-10, 50 mM ammonium acetate-11, 14 mM sodium ascorbate-12, 100% D2O' 3 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id CopK-1 1 ? mM '[U-100% 15N]' 1 'COPPER(I) ION-2' 0.95 ? mM ? 1 'ammonium acetate-3' 50 ? mM ? 1 'sodium ascorbate-4' 10 ? mM ? 1 CopK-5 1.6 ? mM '[U-100% 13C; U-100% 15N]' 2 'COPPER(I) ION-6' 1.5 ? mM ? 2 'ammonium acetate-7' 50 ? mM ? 2 'sodium ascorbate-8' 16 ? mM ? 2 CopK-9 1.5 ? mM ? 3 'COPPER(I) ION-10' 1.4 ? mM ? 3 'ammonium acetate-11' 50 ? mM ? 3 'sodium ascorbate-12' 14 ? mM ? 3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D 1H-15N NOESY' 1 3 2 '3D 1H-13C NOESY' 1 4 3 '2D 1H-1H NOESY' 1 5 2 '3D HNCO' 1 6 2 '3D HNCACB' 1 7 2 '3D HN(COCA)CB' 1 8 2 '3D HNCA' 1 9 2 '3D C(CO)NH' 1 10 2 '3D HCCH-TOCSY' # _pdbx_nmr_refine.entry_id 2KM0 _pdbx_nmr_refine.method 'simulated annealing, molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 1 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRView ? 2 'Torsten Herrmann' 'peak picking' AtnosCandid ? 3 'Torsten Herrmann' 'structure solution' AtnosCandid ? 4 ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA 1.2 5 ;Linge, O'Donoghue and Nilges ; refinement ARIA 1.2 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CU1 CU CU N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 ILE N N N N 145 ILE CA C N S 146 ILE C C N N 147 ILE O O N N 148 ILE CB C N S 149 ILE CG1 C N N 150 ILE CG2 C N N 151 ILE CD1 C N N 152 ILE OXT O N N 153 ILE H H N N 154 ILE H2 H N N 155 ILE HA H N N 156 ILE HB H N N 157 ILE HG12 H N N 158 ILE HG13 H N N 159 ILE HG21 H N N 160 ILE HG22 H N N 161 ILE HG23 H N N 162 ILE HD11 H N N 163 ILE HD12 H N N 164 ILE HD13 H N N 165 ILE HXT H N N 166 LEU N N N N 167 LEU CA C N S 168 LEU C C N N 169 LEU O O N N 170 LEU CB C N N 171 LEU CG C N N 172 LEU CD1 C N N 173 LEU CD2 C N N 174 LEU OXT O N N 175 LEU H H N N 176 LEU H2 H N N 177 LEU HA H N N 178 LEU HB2 H N N 179 LEU HB3 H N N 180 LEU HG H N N 181 LEU HD11 H N N 182 LEU HD12 H N N 183 LEU HD13 H N N 184 LEU HD21 H N N 185 LEU HD22 H N N 186 LEU HD23 H N N 187 LEU HXT H N N 188 LYS N N N N 189 LYS CA C N S 190 LYS C C N N 191 LYS O O N N 192 LYS CB C N N 193 LYS CG C N N 194 LYS CD C N N 195 LYS CE C N N 196 LYS NZ N N N 197 LYS OXT O N N 198 LYS H H N N 199 LYS H2 H N N 200 LYS HA H N N 201 LYS HB2 H N N 202 LYS HB3 H N N 203 LYS HG2 H N N 204 LYS HG3 H N N 205 LYS HD2 H N N 206 LYS HD3 H N N 207 LYS HE2 H N N 208 LYS HE3 H N N 209 LYS HZ1 H N N 210 LYS HZ2 H N N 211 LYS HZ3 H N N 212 LYS HXT H N N 213 MET N N N N 214 MET CA C N S 215 MET C C N N 216 MET O O N N 217 MET CB C N N 218 MET CG C N N 219 MET SD S N N 220 MET CE C N N 221 MET OXT O N N 222 MET H H N N 223 MET H2 H N N 224 MET HA H N N 225 MET HB2 H N N 226 MET HB3 H N N 227 MET HG2 H N N 228 MET HG3 H N N 229 MET HE1 H N N 230 MET HE2 H N N 231 MET HE3 H N N 232 MET HXT H N N 233 PHE N N N N 234 PHE CA C N S 235 PHE C C N N 236 PHE O O N N 237 PHE CB C N N 238 PHE CG C Y N 239 PHE CD1 C Y N 240 PHE CD2 C Y N 241 PHE CE1 C Y N 242 PHE CE2 C Y N 243 PHE CZ C Y N 244 PHE OXT O N N 245 PHE H H N N 246 PHE H2 H N N 247 PHE HA H N N 248 PHE HB2 H N N 249 PHE HB3 H N N 250 PHE HD1 H N N 251 PHE HD2 H N N 252 PHE HE1 H N N 253 PHE HE2 H N N 254 PHE HZ H N N 255 PHE HXT H N N 256 PRO N N N N 257 PRO CA C N S 258 PRO C C N N 259 PRO O O N N 260 PRO CB C N N 261 PRO CG C N N 262 PRO CD C N N 263 PRO OXT O N N 264 PRO H H N N 265 PRO HA H N N 266 PRO HB2 H N N 267 PRO HB3 H N N 268 PRO HG2 H N N 269 PRO HG3 H N N 270 PRO HD2 H N N 271 PRO HD3 H N N 272 PRO HXT H N N 273 SER N N N N 274 SER CA C N S 275 SER C C N N 276 SER O O N N 277 SER CB C N N 278 SER OG O N N 279 SER OXT O N N 280 SER H H N N 281 SER H2 H N N 282 SER HA H N N 283 SER HB2 H N N 284 SER HB3 H N N 285 SER HG H N N 286 SER HXT H N N 287 THR N N N N 288 THR CA C N S 289 THR C C N N 290 THR O O N N 291 THR CB C N R 292 THR OG1 O N N 293 THR CG2 C N N 294 THR OXT O N N 295 THR H H N N 296 THR H2 H N N 297 THR HA H N N 298 THR HB H N N 299 THR HG1 H N N 300 THR HG21 H N N 301 THR HG22 H N N 302 THR HG23 H N N 303 THR HXT H N N 304 TYR N N N N 305 TYR CA C N S 306 TYR C C N N 307 TYR O O N N 308 TYR CB C N N 309 TYR CG C Y N 310 TYR CD1 C Y N 311 TYR CD2 C Y N 312 TYR CE1 C Y N 313 TYR CE2 C Y N 314 TYR CZ C Y N 315 TYR OH O N N 316 TYR OXT O N N 317 TYR H H N N 318 TYR H2 H N N 319 TYR HA H N N 320 TYR HB2 H N N 321 TYR HB3 H N N 322 TYR HD1 H N N 323 TYR HD2 H N N 324 TYR HE1 H N N 325 TYR HE2 H N N 326 TYR HH H N N 327 TYR HXT H N N 328 VAL N N N N 329 VAL CA C N S 330 VAL C C N N 331 VAL O O N N 332 VAL CB C N N 333 VAL CG1 C N N 334 VAL CG2 C N N 335 VAL OXT O N N 336 VAL H H N N 337 VAL H2 H N N 338 VAL HA H N N 339 VAL HB H N N 340 VAL HG11 H N N 341 VAL HG12 H N N 342 VAL HG13 H N N 343 VAL HG21 H N N 344 VAL HG22 H N N 345 VAL HG23 H N N 346 VAL HXT H N N 347 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TYR N CA sing N N 291 TYR N H sing N N 292 TYR N H2 sing N N 293 TYR CA C sing N N 294 TYR CA CB sing N N 295 TYR CA HA sing N N 296 TYR C O doub N N 297 TYR C OXT sing N N 298 TYR CB CG sing N N 299 TYR CB HB2 sing N N 300 TYR CB HB3 sing N N 301 TYR CG CD1 doub Y N 302 TYR CG CD2 sing Y N 303 TYR CD1 CE1 sing Y N 304 TYR CD1 HD1 sing N N 305 TYR CD2 CE2 doub Y N 306 TYR CD2 HD2 sing N N 307 TYR CE1 CZ doub Y N 308 TYR CE1 HE1 sing N N 309 TYR CE2 CZ sing Y N 310 TYR CE2 HE2 sing N N 311 TYR CZ OH sing N N 312 TYR OH HH sing N N 313 TYR OXT HXT sing N N 314 VAL N CA sing N N 315 VAL N H sing N N 316 VAL N H2 sing N N 317 VAL CA C sing N N 318 VAL CA CB sing N N 319 VAL CA HA sing N N 320 VAL C O doub N N 321 VAL C OXT sing N N 322 VAL CB CG1 sing N N 323 VAL CB CG2 sing N N 324 VAL CB HB sing N N 325 VAL CG1 HG11 sing N N 326 VAL CG1 HG12 sing N N 327 VAL CG1 HG13 sing N N 328 VAL CG2 HG21 sing N N 329 VAL CG2 HG22 sing N N 330 VAL CG2 HG23 sing N N 331 VAL OXT HXT sing N N 332 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian 'Direct Drive' 1 'Varian DirectDrive' 800 Varian 'Direct Drive' 2 'Varian DirectDrive' # _atom_sites.entry_id 2KM0 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CU H N O S # loop_