data_2KNP # _entry.id 2KNP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KNP pdb_00002knp 10.2210/pdb2knp/pdb RCSB RCSB101347 ? ? WWPDB D_1000101347 ? ? # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KNP _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2009-08-30 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Daly, N.L.' 1 'Chan, L.' 2 # _citation.id primary _citation.title 'Isolation and characterization of peptides from Momordica cochinchinensis seeds.' _citation.journal_abbrev J.Nat.Prod. _citation.journal_volume 72 _citation.page_first 1453 _citation.page_last 1458 _citation.year 2009 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 0163-3864 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19711988 _citation.pdbx_database_id_DOI 10.1021/np900174n # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chan, L.Y.' 1 ? primary 'Wang, C.K.' 2 ? primary 'Major, J.M.' 3 ? primary 'Greenwood, K.P.' 4 ? primary 'Lewis, R.J.' 5 ? primary 'Craik, D.J.' 6 ? primary 'Daly, N.L.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description MCoCC-1 _entity.formula_weight 3296.805 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GCEGKQCGLFRSCGGGCRCWPTVTPGVGICSSS _entity_poly.pdbx_seq_one_letter_code_can GCEGKQCGLFRSCGGGCRCWPTVTPGVGICSSS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 CYS n 1 3 GLU n 1 4 GLY n 1 5 LYS n 1 6 GLN n 1 7 CYS n 1 8 GLY n 1 9 LEU n 1 10 PHE n 1 11 ARG n 1 12 SER n 1 13 CYS n 1 14 GLY n 1 15 GLY n 1 16 GLY n 1 17 CYS n 1 18 ARG n 1 19 CYS n 1 20 TRP n 1 21 PRO n 1 22 THR n 1 23 VAL n 1 24 THR n 1 25 PRO n 1 26 GLY n 1 27 VAL n 1 28 GLY n 1 29 ILE n 1 30 CYS n 1 31 SER n 1 32 SER n 1 33 SER n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Momordica cochinchinensis' _entity_src_nat.pdbx_ncbi_taxonomy_id 3674 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue seeds _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 2KNP _struct_ref.pdbx_db_accession 2KNP _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KNP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 33 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 2KNP _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 33 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 33 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D DQF-COSY' 1 2 1 '2D 1H-1H NOESY' 1 3 1 '2D 1H-1H TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '2mg/mL MCoCC-1-1, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker AVANCE 1 'Bruker Avance' 600 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2KNP _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KNP _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KNP _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal ? 'chemical shift calculation' CNS 1.1 1 ? 'chemical shift assignment' CNS 1.1 2 ? 'data analysis' CNS 1.1 3 ? refinement CNS 1.1 4 ? processing CNS 1.1 5 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KNP _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KNP _struct.title 'Isolation and characterization of peptides from Momordica cochinchinensis seeds.' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KNP _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' _struct_keywords.text ;Momordica cochinchinensis, Disulfide-rich peptides, cystine knot motif, cytotoxic, melanoma cell line, non-hemolytic, seeds extract, MCoCC-1, MCoCC-2, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 2 SG ? ? ? 1_555 A CYS 17 SG ? ? A CYS 2 A CYS 17 1_555 ? ? ? ? ? ? ? 2.026 ? ? disulf2 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 19 SG ? ? A CYS 7 A CYS 19 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf3 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 30 SG ? ? A CYS 13 A CYS 30 1_555 ? ? ? ? ? ? ? 2.030 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 5 ? GLY A 8 ? LYS A 5 GLY A 8 A 2 VAL A 27 ? CYS A 30 ? VAL A 27 CYS A 30 A 3 CYS A 19 ? PRO A 21 ? CYS A 19 PRO A 21 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 5 ? N LYS A 5 O CYS A 30 ? O CYS A 30 A 2 3 O ILE A 29 ? O ILE A 29 N TRP A 20 ? N TRP A 20 # _atom_sites.entry_id 2KNP _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 CYS 2 2 2 CYS CYS A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 TRP 20 20 20 TRP TRP A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 SER 33 33 33 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-11-10 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_spectrometer 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_entry_details.sequence_details 'A SEQUENCE DATABASE REFERENCE FOR THIS PROTEIN DOES NOT CURRENTLY EXIST.' _pdbx_entry_details.entry_id 2KNP _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest ? # _pdbx_nmr_exptl_sample.component MCoCC-1-1 _pdbx_nmr_exptl_sample.concentration 2 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mg/mL _pdbx_nmr_exptl_sample.isotopic_labeling ? _pdbx_nmr_exptl_sample.solution_id 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HH21 A ARG 18 ? ? O A SER 33 ? ? 1.59 2 2 H3 A GLY 1 ? ? OE1 A GLU 3 ? ? 1.54 3 3 HH21 A ARG 18 ? ? O A SER 33 ? ? 1.58 4 4 H1 A GLY 1 ? ? OE1 A GLU 3 ? ? 1.56 5 4 HH21 A ARG 18 ? ? O A SER 33 ? ? 1.57 6 5 H2 A GLY 1 ? ? OE1 A GLU 3 ? ? 1.58 7 5 HH11 A ARG 18 ? ? O A SER 33 ? ? 1.60 8 8 H3 A GLY 1 ? ? OE2 A GLU 3 ? ? 1.58 9 10 H1 A GLY 1 ? ? OE1 A GLU 3 ? ? 1.57 10 10 HH11 A ARG 18 ? ? OXT A SER 33 ? ? 1.58 11 11 H2 A GLY 1 ? ? OE1 A GLU 3 ? ? 1.54 12 12 H1 A GLY 1 ? ? OE2 A GLU 3 ? ? 1.56 13 13 HH21 A ARG 18 ? ? OXT A SER 33 ? ? 1.60 14 16 H2 A GLY 1 ? ? OE1 A GLU 3 ? ? 1.55 15 17 HH21 A ARG 18 ? ? O A SER 33 ? ? 1.56 16 17 H3 A GLY 1 ? ? OE1 A GLU 3 ? ? 1.59 17 20 HH21 A ARG 18 ? ? O A SER 33 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 22 ? ? -110.37 -147.43 2 2 CYS A 7 ? ? -127.59 -169.91 3 2 LEU A 9 ? ? -70.72 -74.62 4 2 THR A 22 ? ? -106.42 -152.21 5 3 LEU A 9 ? ? -73.14 -72.45 6 3 THR A 22 ? ? -107.08 -153.99 7 3 SER A 31 ? ? -106.47 -166.10 8 4 LEU A 9 ? ? 69.32 -81.48 9 4 THR A 22 ? ? -110.09 -149.60 10 4 PRO A 25 ? ? -58.36 109.75 11 4 SER A 31 ? ? -107.68 -167.94 12 5 PHE A 10 ? ? -107.84 55.62 13 5 THR A 22 ? ? -108.71 -150.68 14 6 LEU A 9 ? ? 55.86 -96.53 15 6 THR A 22 ? ? -108.19 -150.50 16 6 PRO A 25 ? ? -58.26 108.39 17 7 THR A 22 ? ? -105.70 -154.39 18 7 PRO A 25 ? ? -57.90 109.51 19 8 LEU A 9 ? ? -73.77 -83.35 20 8 THR A 22 ? ? -108.28 -150.84 21 9 CYS A 7 ? ? -115.23 -92.50 22 9 LEU A 9 ? ? -94.85 38.42 23 9 PHE A 10 ? ? -145.32 -23.84 24 9 THR A 22 ? ? -107.64 -152.50 25 9 PRO A 25 ? ? -57.71 106.42 26 10 THR A 22 ? ? -109.67 -152.78 27 10 PRO A 25 ? ? -59.46 109.55 28 11 ARG A 11 ? ? -68.90 98.19 29 11 THR A 22 ? ? -105.00 -153.74 30 12 CYS A 7 ? ? -117.60 -166.73 31 12 PHE A 10 ? ? -106.68 72.19 32 12 THR A 22 ? ? -108.40 -151.65 33 13 LEU A 9 ? ? 71.18 -85.99 34 13 SER A 12 ? ? -102.21 75.61 35 13 THR A 22 ? ? -108.92 -151.76 36 14 CYS A 7 ? ? -121.96 -167.33 37 14 PHE A 10 ? ? -96.37 47.49 38 14 THR A 22 ? ? -99.62 -154.80 39 15 CYS A 7 ? ? -121.74 -159.67 40 15 PHE A 10 ? ? -106.83 49.61 41 15 ARG A 11 ? ? -69.68 93.07 42 15 SER A 12 ? ? -91.93 49.33 43 15 THR A 22 ? ? -107.49 -150.89 44 16 CYS A 7 ? ? -130.13 -158.24 45 16 THR A 22 ? ? -106.09 -153.77 46 16 SER A 31 ? ? -119.39 -166.06 47 17 LEU A 9 ? ? 70.41 -81.48 48 17 THR A 22 ? ? -105.92 -153.56 49 17 PRO A 25 ? ? -58.24 108.04 50 18 CYS A 7 ? ? -124.02 -164.41 51 18 THR A 22 ? ? -103.08 -152.29 52 19 THR A 22 ? ? -108.16 -150.34 53 19 PRO A 25 ? ? -59.28 108.71 54 19 SER A 31 ? ? -117.65 -165.56 55 20 THR A 22 ? ? -114.86 -151.01 #