data_2KOK # _entry.id 2KOK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KOK pdb_00002kok 10.2210/pdb2kok/pdb RCSB RCSB101377 ? ? WWPDB D_1000101377 ? ? BMRB 16517 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type TargetDB BrabA.00007.a . unspecified BMRB 16517 . unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KOK _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-09-23 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Buchko, G.W.' 1 'Hewitt, S.N.' 2 'Napuli, A.J.' 3 'Van Voorhis, W.C.' 4 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' 5 # _citation.id primary _citation.title ;Solution structure of an arsenate reductase-related protein, YffB, from Brucella melitensis, the etiological agent responsible for brucellosis. ; _citation.journal_abbrev 'Acta Crystallogr.,Sect.F' _citation.journal_volume 67 _citation.page_first 1129 _citation.page_last 1136 _citation.year 2011 _citation.journal_id_ASTM ? _citation.country DK _citation.journal_id_ISSN 1744-3091 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21904062 _citation.pdbx_database_id_DOI 10.1107/S1744309111006336 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Buchko, G.W.' 1 ? primary 'Hewitt, S.N.' 2 ? primary 'Napuli, A.J.' 3 ? primary 'Van Voorhis, W.C.' 4 ? primary 'Myler, P.J.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'arsenate reductase' _entity.formula_weight 13777.872 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPGSMSVTIYGIKNCDTMKKARIWLEDHGIDYTFHDYKKEGLDAETLDRFLKTVPWEQLLNRAGTTFRKLPEDVRSNVDA ASARELMLAQPSMVKRPVLERDGKLMVGFKPAQYEAYFKL ; _entity_poly.pdbx_seq_one_letter_code_can ;GPGSMSVTIYGIKNCDTMKKARIWLEDHGIDYTFHDYKKEGLDAETLDRFLKTVPWEQLLNRAGTTFRKLPEDVRSNVDA ASARELMLAQPSMVKRPVLERDGKLMVGFKPAQYEAYFKL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier BrabA.00007.a # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLY n 1 4 SER n 1 5 MET n 1 6 SER n 1 7 VAL n 1 8 THR n 1 9 ILE n 1 10 TYR n 1 11 GLY n 1 12 ILE n 1 13 LYS n 1 14 ASN n 1 15 CYS n 1 16 ASP n 1 17 THR n 1 18 MET n 1 19 LYS n 1 20 LYS n 1 21 ALA n 1 22 ARG n 1 23 ILE n 1 24 TRP n 1 25 LEU n 1 26 GLU n 1 27 ASP n 1 28 HIS n 1 29 GLY n 1 30 ILE n 1 31 ASP n 1 32 TYR n 1 33 THR n 1 34 PHE n 1 35 HIS n 1 36 ASP n 1 37 TYR n 1 38 LYS n 1 39 LYS n 1 40 GLU n 1 41 GLY n 1 42 LEU n 1 43 ASP n 1 44 ALA n 1 45 GLU n 1 46 THR n 1 47 LEU n 1 48 ASP n 1 49 ARG n 1 50 PHE n 1 51 LEU n 1 52 LYS n 1 53 THR n 1 54 VAL n 1 55 PRO n 1 56 TRP n 1 57 GLU n 1 58 GLN n 1 59 LEU n 1 60 LEU n 1 61 ASN n 1 62 ARG n 1 63 ALA n 1 64 GLY n 1 65 THR n 1 66 THR n 1 67 PHE n 1 68 ARG n 1 69 LYS n 1 70 LEU n 1 71 PRO n 1 72 GLU n 1 73 ASP n 1 74 VAL n 1 75 ARG n 1 76 SER n 1 77 ASN n 1 78 VAL n 1 79 ASP n 1 80 ALA n 1 81 ALA n 1 82 SER n 1 83 ALA n 1 84 ARG n 1 85 GLU n 1 86 LEU n 1 87 MET n 1 88 LEU n 1 89 ALA n 1 90 GLN n 1 91 PRO n 1 92 SER n 1 93 MET n 1 94 VAL n 1 95 LYS n 1 96 ARG n 1 97 PRO n 1 98 VAL n 1 99 LEU n 1 100 GLU n 1 101 ARG n 1 102 ASP n 1 103 GLY n 1 104 LYS n 1 105 LEU n 1 106 MET n 1 107 VAL n 1 108 GLY n 1 109 PHE n 1 110 LYS n 1 111 PRO n 1 112 ALA n 1 113 GLN n 1 114 TYR n 1 115 GLU n 1 116 ALA n 1 117 TYR n 1 118 PHE n 1 119 LYS n 1 120 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ArsC, BruAb1_0395' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'BIOVAR ABORTUS 2308' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Brucella abortus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 235 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name AVA0421 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q57EZ2_BRUAB _struct_ref.pdbx_db_accession Q57EZ2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSVTIYGIKNCDTMKKARIWLEDHGIDYTFHDYKKEGLDAETLDRFLKTVPWEQLLNRAGTTFRKLPEDVRSNVDAASAR ELMLAQPSMVKRPVLERDGKLMVGFKPAQYEAYFKL ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KOK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 120 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q57EZ2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 116 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 120 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KOK GLY A 1 ? UNP Q57EZ2 ? ? 'expression tag' 1 1 1 2KOK PRO A 2 ? UNP Q57EZ2 ? ? 'expression tag' 2 2 1 2KOK GLY A 3 ? UNP Q57EZ2 ? ? 'expression tag' 3 3 1 2KOK SER A 4 ? UNP Q57EZ2 ? ? 'expression tag' 4 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D 1H-15N NOESY' 1 4 1 '3D 1H-13C NOESY' 1 5 1 '3D HNCO' 1 6 1 '3D HNCACB' 1 7 1 '3D HN(CO)CA' 1 8 1 '3D C(CO)NH' 1 9 1 '3D H(CCO)NH' 1 10 2 'deuterium exchange' 1 11 1 '3D HBHA(CO)NH' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.12 _pdbx_nmr_exptl_sample_conditions.pH 7.1 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1.5 mM BR7, 100 mM sodium chloride, 20 mM TRIS, 1 mM DTT, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1.0 mM BR7, 100 mM sodium chloride, 20 mM TRIS, 1 mM DTT, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 750 Varian INOVA 1 'Varian INOVA' 600 Varian INOVA 2 'Varian INOVA' 800 Varian INOVA 3 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2KOK _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details 'STRUCTURE DETERMINATION WAS PERFORMED ITERATIVELY USING CYANA (AUTO NOESYASSIGN).' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KOK _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KOK _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 1 'Accelrys Software Inc.' processing Felix 2007 2 Goddard 'data analysis' Sparky 3.115 3 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.1 4 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KOK _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KOK _struct.title ;Solution structure of an arsenate reductase (ArsC) related protein from Brucella melitensis. Seattle Structural Genomics Center for Infectious Disease target BrabA.00007.a. ; _struct.pdbx_model_details 'closest to the average, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KOK _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text ;arsenate reductase, brucellosis, zoonotic, OXIDOREDUCTASE, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 15 ? GLY A 29 ? CYS A 15 GLY A 29 1 ? 15 HELX_P HELX_P2 2 TYR A 37 ? GLY A 41 ? TYR A 37 GLY A 41 1 ? 5 HELX_P HELX_P3 3 ASP A 43 ? VAL A 54 ? ASP A 43 VAL A 54 1 ? 12 HELX_P HELX_P4 4 PRO A 55 ? LEU A 59 ? PRO A 55 LEU A 59 5 ? 5 HELX_P HELX_P5 5 GLY A 64 ? LEU A 70 ? GLY A 64 LEU A 70 1 ? 7 HELX_P HELX_P6 6 PRO A 71 ? ASN A 77 ? PRO A 71 ASN A 77 1 ? 7 HELX_P HELX_P7 7 ASP A 79 ? GLN A 90 ? ASP A 79 GLN A 90 1 ? 12 HELX_P HELX_P8 8 PRO A 91 ? VAL A 94 ? PRO A 91 VAL A 94 5 ? 4 HELX_P HELX_P9 9 LYS A 110 ? LYS A 119 ? LYS A 110 LYS A 119 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ARG 96 A . ? ARG 96 A PRO 97 A ? PRO 97 A 1 0.01 2 ARG 96 A . ? ARG 96 A PRO 97 A ? PRO 97 A 2 -0.01 3 ARG 96 A . ? ARG 96 A PRO 97 A ? PRO 97 A 3 0.05 4 ARG 96 A . ? ARG 96 A PRO 97 A ? PRO 97 A 4 0.03 5 ARG 96 A . ? ARG 96 A PRO 97 A ? PRO 97 A 5 -0.11 6 ARG 96 A . ? ARG 96 A PRO 97 A ? PRO 97 A 6 -0.16 7 ARG 96 A . ? ARG 96 A PRO 97 A ? PRO 97 A 7 -0.12 8 ARG 96 A . ? ARG 96 A PRO 97 A ? PRO 97 A 8 0.06 9 ARG 96 A . ? ARG 96 A PRO 97 A ? PRO 97 A 9 0.10 10 ARG 96 A . ? ARG 96 A PRO 97 A ? PRO 97 A 10 0.01 11 ARG 96 A . ? ARG 96 A PRO 97 A ? PRO 97 A 11 0.07 12 ARG 96 A . ? ARG 96 A PRO 97 A ? PRO 97 A 12 -0.10 13 ARG 96 A . ? ARG 96 A PRO 97 A ? PRO 97 A 13 -0.01 14 ARG 96 A . ? ARG 96 A PRO 97 A ? PRO 97 A 14 -0.04 15 ARG 96 A . ? ARG 96 A PRO 97 A ? PRO 97 A 15 0.00 16 ARG 96 A . ? ARG 96 A PRO 97 A ? PRO 97 A 16 -0.02 17 ARG 96 A . ? ARG 96 A PRO 97 A ? PRO 97 A 17 -0.06 18 ARG 96 A . ? ARG 96 A PRO 97 A ? PRO 97 A 18 0.02 19 ARG 96 A . ? ARG 96 A PRO 97 A ? PRO 97 A 19 0.16 20 ARG 96 A . ? ARG 96 A PRO 97 A ? PRO 97 A 20 -0.15 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 32 ? ASP A 36 ? TYR A 32 ASP A 36 A 2 VAL A 7 ? GLY A 11 ? VAL A 7 GLY A 11 A 3 VAL A 98 ? ARG A 101 ? VAL A 98 ARG A 101 A 4 LYS A 104 ? VAL A 107 ? LYS A 104 VAL A 107 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O THR A 33 ? O THR A 33 N ILE A 9 ? N ILE A 9 A 2 3 N TYR A 10 ? N TYR A 10 O VAL A 98 ? O VAL A 98 A 3 4 N LEU A 99 ? N LEU A 99 O MET A 106 ? O MET A 106 # _atom_sites.entry_id 2KOK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 MET 5 5 5 MET MET A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 TRP 24 24 24 TRP TRP A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 TRP 56 56 56 TRP TRP A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 MET 87 87 87 MET MET A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 MET 93 93 93 MET MET A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 MET 106 106 106 MET MET A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 PHE 109 109 109 PHE PHE A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 PRO 111 111 111 PRO PRO A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 GLN 113 113 113 GLN GLN A . n A 1 114 TYR 114 114 114 TYR TYR A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 TYR 117 117 117 TYR TYR A . n A 1 118 PHE 118 118 118 PHE PHE A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 LEU 120 120 120 LEU LEU A . n # _pdbx_SG_project.full_name_of_center 'Seattle Structural Genomics Center for Infectious Disease' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center SSGCID _pdbx_SG_project.project_name ? # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-10-13 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2011-09-21 4 'Structure model' 1 3 2020-02-26 5 'Structure model' 1 4 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other 6 5 'Structure model' 'Database references' 7 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' struct_ref_seq_dif 5 5 'Structure model' database_2 6 5 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.status_code_cs' 2 4 'Structure model' '_pdbx_nmr_software.name' 3 4 'Structure model' '_struct_ref_seq_dif.details' 4 5 'Structure model' '_database_2.pdbx_DOI' 5 5 'Structure model' '_database_2.pdbx_database_accession' 6 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id BR7-1 1.5 ? mM ? 1 'sodium chloride-2' 100 ? mM ? 1 TRIS-3 20 ? mM ? 1 DTT-4 1 ? mM ? 1 BR7-5 1.0 ? mM ? 2 'sodium chloride-6' 100 ? mM ? 2 TRIS-7 20 ? mM ? 2 DTT-8 1 ? mM ? 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2KOK _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1054 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 436 _pdbx_nmr_constraints.NOE_long_range_total_count 323 _pdbx_nmr_constraints.NOE_medium_range_total_count 282 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 449 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 94 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 94 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 2 ? ? -69.85 -178.55 2 1 PRO A 71 ? ? -69.70 -176.43 3 1 ASN A 77 ? ? -101.40 42.52 4 2 ASN A 77 ? ? -93.26 42.45 5 3 PRO A 2 ? ? -69.73 -172.14 6 3 ASN A 14 ? ? -142.75 45.85 7 4 LYS A 13 ? ? -95.14 50.24 8 4 ASN A 14 ? ? -155.79 30.09 9 4 TYR A 32 ? ? -172.02 134.54 10 4 GLU A 40 ? ? -84.48 -70.51 11 4 PRO A 71 ? ? -69.80 -179.48 12 4 ASN A 77 ? ? -93.10 42.72 13 4 PHE A 118 ? ? -96.88 30.31 14 5 ASN A 14 ? ? -105.64 69.93 15 5 PRO A 71 ? ? -69.66 -179.17 16 5 GLN A 90 ? ? -118.97 78.84 17 6 ASN A 77 ? ? -92.95 42.76 18 7 PRO A 71 ? ? -69.61 -178.42 19 7 GLN A 90 ? ? -119.41 79.31 20 7 ARG A 101 ? ? -160.01 112.97 21 8 ASN A 14 ? ? 63.36 60.01 22 8 PRO A 71 ? ? -69.76 -177.28 23 8 ARG A 101 ? ? -172.58 127.11 24 9 GLU A 40 ? ? -85.32 -74.06 25 10 ARG A 101 ? ? -172.06 124.32 26 11 PRO A 2 ? ? -69.87 -171.52 27 11 ASN A 14 ? ? -140.15 46.27 28 11 ASN A 77 ? ? -92.94 42.67 29 12 ASN A 14 ? ? -94.19 39.14 30 12 ARG A 101 ? ? -171.25 119.99 31 13 PRO A 71 ? ? -69.72 -177.65 32 13 GLN A 90 ? ? -114.31 73.74 33 13 ARG A 101 ? ? -160.48 116.39 34 14 PRO A 2 ? ? -69.81 -171.74 35 14 ASN A 77 ? ? -97.00 42.67 36 15 PRO A 2 ? ? -69.74 -171.92 37 15 ASN A 14 ? ? -93.40 59.13 38 15 ASN A 77 ? ? -95.13 36.57 39 15 GLN A 90 ? ? -113.39 75.92 40 15 ARG A 101 ? ? -171.67 141.60 41 15 PHE A 118 ? ? -96.40 30.21 42 16 PHE A 118 ? ? -96.56 30.42 43 17 TYR A 32 ? ? -173.29 135.19 44 17 PRO A 71 ? ? -69.75 -177.87 45 17 ARG A 101 ? ? -174.85 141.60 46 18 ASN A 77 ? ? -93.65 42.43 47 19 LYS A 95 ? ? -52.01 171.12 48 20 ASN A 14 ? ? -103.34 70.10 49 20 ALA A 63 ? ? -93.79 30.21 50 20 PRO A 71 ? ? -69.79 -179.72 #