data_2KQB # _entry.id 2KQB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KQB pdb_00002kqb 10.2210/pdb2kqb/pdb RCSB RCSB101440 ? ? BMRB 16596 ? 10.13018/BMR16596 WWPDB D_1000101440 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-01-19 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-26 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Derived calculations' 8 4 'Structure model' Other 9 5 'Structure model' 'Data collection' 10 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_database_status 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif 7 4 'Structure model' database_2 8 4 'Structure model' pdbx_database_status 9 4 'Structure model' pdbx_struct_conn_angle 10 4 'Structure model' struct_conn 11 4 'Structure model' struct_site 12 5 'Structure model' chem_comp_atom 13 5 'Structure model' chem_comp_bond 14 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 3 'Structure model' '_struct_ref_seq_dif.details' 5 4 'Structure model' '_database_2.pdbx_DOI' 6 4 'Structure model' '_database_2.pdbx_database_accession' 7 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 18 4 'Structure model' '_pdbx_struct_conn_angle.value' 19 4 'Structure model' '_struct_conn.pdbx_dist_value' 20 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 21 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 24 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 25 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 26 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 27 4 'Structure model' '_struct_site.pdbx_auth_seq_id' 28 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KQB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-11-04 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 16596 BMRB unspecified 'chemical shifts for this system' 2KQC PDB unspecified 'SECOND PBZ DOMAIN OF HUMAN APLF PROTEIN' 2KQD PDB unspecified 'FIRST PBZ DOMAIN OF HUMAN APLF PROTEIN IN COMPLEX WITH RIBOFURANOSYLADENOSINE' 2KQE PDB unspecified 'SECOND PBZ DOMAIN OF HUMAN APLF PROTEIN IN COMPLEX WITH RIBOFURANOSYLADENOSINE' # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Neuhaus, D.' 1 'Eustermann, S.' 2 'Brockmann, C.' 3 'Yang, J.' 4 # _citation.id primary _citation.title 'Solution structures of the two PBZ domains from human APLF and their interaction with poly(ADP-ribose).' _citation.journal_abbrev Nat.Struct.Mol.Biol. _citation.journal_volume 17 _citation.page_first 241 _citation.page_last 243 _citation.year 2010 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1545-9993 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20098424 _citation.pdbx_database_id_DOI 10.1038/nsmb.1747 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Eustermann, S.' 1 ? primary 'Brockmann, C.' 2 ? primary 'Mehrotra, P.V.' 3 ? primary 'Yang, J.C.' 4 ? primary 'Loakes, D.' 5 ? primary 'West, S.C.' 6 ? primary 'Ahel, I.' 7 ? primary 'Neuhaus, D.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Aprataxin and PNK-like factor' 10053.062 1 4.2.99.18 ? 'sequence database residues 363-451, PBZ-type 1 domain' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Apurinic-apyrimidinic endonuclease APLF, PNK and APTX-like FHA domain-containing protein, XRCC1-interacting protein 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPLGSGSEGNKVKRTSCMYGANCYRKNPVHFQHFSHPGDSDYGGVQIVGQDETDDRPECPYGPSCYRKNPQHKIEYRHNT LPVRNVLDE ; _entity_poly.pdbx_seq_one_letter_code_can ;GPLGSGSEGNKVKRTSCMYGANCYRKNPVHFQHFSHPGDSDYGGVQIVGQDETDDRPECPYGPSCYRKNPQHKIEYRHNT LPVRNVLDE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 GLY n 1 7 SER n 1 8 GLU n 1 9 GLY n 1 10 ASN n 1 11 LYS n 1 12 VAL n 1 13 LYS n 1 14 ARG n 1 15 THR n 1 16 SER n 1 17 CYS n 1 18 MET n 1 19 TYR n 1 20 GLY n 1 21 ALA n 1 22 ASN n 1 23 CYS n 1 24 TYR n 1 25 ARG n 1 26 LYS n 1 27 ASN n 1 28 PRO n 1 29 VAL n 1 30 HIS n 1 31 PHE n 1 32 GLN n 1 33 HIS n 1 34 PHE n 1 35 SER n 1 36 HIS n 1 37 PRO n 1 38 GLY n 1 39 ASP n 1 40 SER n 1 41 ASP n 1 42 TYR n 1 43 GLY n 1 44 GLY n 1 45 VAL n 1 46 GLN n 1 47 ILE n 1 48 VAL n 1 49 GLY n 1 50 GLN n 1 51 ASP n 1 52 GLU n 1 53 THR n 1 54 ASP n 1 55 ASP n 1 56 ARG n 1 57 PRO n 1 58 GLU n 1 59 CYS n 1 60 PRO n 1 61 TYR n 1 62 GLY n 1 63 PRO n 1 64 SER n 1 65 CYS n 1 66 TYR n 1 67 ARG n 1 68 LYS n 1 69 ASN n 1 70 PRO n 1 71 GLN n 1 72 HIS n 1 73 LYS n 1 74 ILE n 1 75 GLU n 1 76 TYR n 1 77 ARG n 1 78 HIS n 1 79 ASN n 1 80 THR n 1 81 LEU n 1 82 PRO n 1 83 VAL n 1 84 ARG n 1 85 ASN n 1 86 VAL n 1 87 LEU n 1 88 ASP n 1 89 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'APLF, C2orf13, PALF, XIP1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pGEX-6P-1 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 363 363 GLY GLY A . n A 1 2 PRO 2 364 364 PRO PRO A . n A 1 3 LEU 3 365 365 LEU LEU A . n A 1 4 GLY 4 366 366 GLY GLY A . n A 1 5 SER 5 367 367 SER SER A . n A 1 6 GLY 6 368 368 GLY GLY A . n A 1 7 SER 7 369 369 SER SER A . n A 1 8 GLU 8 370 370 GLU GLU A . n A 1 9 GLY 9 371 371 GLY GLY A . n A 1 10 ASN 10 372 372 ASN ASN A . n A 1 11 LYS 11 373 373 LYS LYS A . n A 1 12 VAL 12 374 374 VAL VAL A . n A 1 13 LYS 13 375 375 LYS LYS A . n A 1 14 ARG 14 376 376 ARG ARG A . n A 1 15 THR 15 377 377 THR THR A . n A 1 16 SER 16 378 378 SER SER A . n A 1 17 CYS 17 379 379 CYS CYS A . n A 1 18 MET 18 380 380 MET MET A . n A 1 19 TYR 19 381 381 TYR TYR A . n A 1 20 GLY 20 382 382 GLY GLY A . n A 1 21 ALA 21 383 383 ALA ALA A . n A 1 22 ASN 22 384 384 ASN ASN A . n A 1 23 CYS 23 385 385 CYS CYS A . n A 1 24 TYR 24 386 386 TYR TYR A . n A 1 25 ARG 25 387 387 ARG ARG A . n A 1 26 LYS 26 388 388 LYS LYS A . n A 1 27 ASN 27 389 389 ASN ASN A . n A 1 28 PRO 28 390 390 PRO PRO A . n A 1 29 VAL 29 391 391 VAL VAL A . n A 1 30 HIS 30 392 392 HIS HIS A . n A 1 31 PHE 31 393 393 PHE PHE A . n A 1 32 GLN 32 394 394 GLN GLN A . n A 1 33 HIS 33 395 395 HIS HIS A . n A 1 34 PHE 34 396 396 PHE PHE A . n A 1 35 SER 35 397 397 SER SER A . n A 1 36 HIS 36 398 398 HIS HIS A . n A 1 37 PRO 37 399 399 PRO PRO A . n A 1 38 GLY 38 400 400 GLY GLY A . n A 1 39 ASP 39 401 401 ASP ASP A . n A 1 40 SER 40 402 402 SER SER A . n A 1 41 ASP 41 403 403 ASP ASP A . n A 1 42 TYR 42 404 404 TYR TYR A . n A 1 43 GLY 43 405 405 GLY GLY A . n A 1 44 GLY 44 406 406 GLY GLY A . n A 1 45 VAL 45 407 407 VAL VAL A . n A 1 46 GLN 46 408 408 GLN GLN A . n A 1 47 ILE 47 409 409 ILE ILE A . n A 1 48 VAL 48 410 410 VAL VAL A . n A 1 49 GLY 49 411 411 GLY GLY A . n A 1 50 GLN 50 412 412 GLN GLN A . n A 1 51 ASP 51 413 413 ASP ASP A . n A 1 52 GLU 52 414 414 GLU GLU A . n A 1 53 THR 53 415 415 THR THR A . n A 1 54 ASP 54 416 416 ASP ASP A . n A 1 55 ASP 55 417 417 ASP ASP A . n A 1 56 ARG 56 418 ? ? ? A . n A 1 57 PRO 57 419 ? ? ? A . n A 1 58 GLU 58 420 ? ? ? A . n A 1 59 CYS 59 421 ? ? ? A . n A 1 60 PRO 60 422 ? ? ? A . n A 1 61 TYR 61 423 ? ? ? A . n A 1 62 GLY 62 424 ? ? ? A . n A 1 63 PRO 63 425 ? ? ? A . n A 1 64 SER 64 426 ? ? ? A . n A 1 65 CYS 65 427 ? ? ? A . n A 1 66 TYR 66 428 ? ? ? A . n A 1 67 ARG 67 429 ? ? ? A . n A 1 68 LYS 68 430 ? ? ? A . n A 1 69 ASN 69 431 ? ? ? A . n A 1 70 PRO 70 432 ? ? ? A . n A 1 71 GLN 71 433 ? ? ? A . n A 1 72 HIS 72 434 ? ? ? A . n A 1 73 LYS 73 435 ? ? ? A . n A 1 74 ILE 74 436 ? ? ? A . n A 1 75 GLU 75 437 ? ? ? A . n A 1 76 TYR 76 438 ? ? ? A . n A 1 77 ARG 77 439 ? ? ? A . n A 1 78 HIS 78 440 ? ? ? A . n A 1 79 ASN 79 441 ? ? ? A . n A 1 80 THR 80 442 ? ? ? A . n A 1 81 LEU 81 443 ? ? ? A . n A 1 82 PRO 82 444 ? ? ? A . n A 1 83 VAL 83 445 ? ? ? A . n A 1 84 ARG 84 446 ? ? ? A . n A 1 85 ASN 85 447 ? ? ? A . n A 1 86 VAL 86 448 ? ? ? A . n A 1 87 LEU 87 449 ? ? ? A . n A 1 88 ASP 88 450 ? ? ? A . n A 1 89 GLU 89 451 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 1001 _pdbx_nonpoly_scheme.auth_seq_num 1001 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _cell.entry_id 2KQB _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2KQB _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KQB _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KQB _struct.title 'First PBZ domain of human APLF protein' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KQB _struct_keywords.pdbx_keywords LYASE _struct_keywords.text 'ADP-ribosylation, DNA damage, DNA repair, Metal-binding, Nucleotide-binding, Nucleus, Zinc, Zinc-finger, LYASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code APLF_HUMAN _struct_ref.pdbx_db_accession Q8IW19 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GSEGNKVKRTSCMYGANCYRKNPVHFQHFSHPGDSDYGGVQIVGQDETDDRPECPYGPSCYRKNPQHKIEYRHNTLPVRN VLDE ; _struct_ref.pdbx_align_begin 368 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KQB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 89 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8IW19 _struct_ref_seq.db_align_beg 368 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 451 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 368 _struct_ref_seq.pdbx_auth_seq_align_end 451 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KQB GLY A 1 ? UNP Q8IW19 ? ? 'expression tag' 363 1 1 2KQB PRO A 2 ? UNP Q8IW19 ? ? 'expression tag' 364 2 1 2KQB LEU A 3 ? UNP Q8IW19 ? ? 'expression tag' 365 3 1 2KQB GLY A 4 ? UNP Q8IW19 ? ? 'expression tag' 366 4 1 2KQB SER A 5 ? UNP Q8IW19 ? ? 'expression tag' 367 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id VAL _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 29 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id HIS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 33 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id VAL _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 391 _struct_conf.end_auth_comp_id HIS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 395 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 17 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 379 A ZN 1001 1_555 ? ? ? ? ? ? ? 2.276 ? ? metalc2 metalc ? ? A CYS 23 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 385 A ZN 1001 1_555 ? ? ? ? ? ? ? 2.454 ? ? metalc3 metalc ? ? A HIS 30 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 392 A ZN 1001 1_555 ? ? ? ? ? ? ? 2.028 ? ? metalc4 metalc ? ? A HIS 36 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 398 A ZN 1001 1_555 ? ? ? ? ? ? ? 2.037 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 17 ? A CYS 379 ? 1_555 ZN ? B ZN . ? A ZN 1001 ? 1_555 SG ? A CYS 23 ? A CYS 385 ? 1_555 108.6 ? 2 SG ? A CYS 17 ? A CYS 379 ? 1_555 ZN ? B ZN . ? A ZN 1001 ? 1_555 NE2 ? A HIS 30 ? A HIS 392 ? 1_555 105.7 ? 3 SG ? A CYS 23 ? A CYS 385 ? 1_555 ZN ? B ZN . ? A ZN 1001 ? 1_555 NE2 ? A HIS 30 ? A HIS 392 ? 1_555 113.0 ? 4 SG ? A CYS 17 ? A CYS 379 ? 1_555 ZN ? B ZN . ? A ZN 1001 ? 1_555 NE2 ? A HIS 36 ? A HIS 398 ? 1_555 108.3 ? 5 SG ? A CYS 23 ? A CYS 385 ? 1_555 ZN ? B ZN . ? A ZN 1001 ? 1_555 NE2 ? A HIS 36 ? A HIS 398 ? 1_555 111.3 ? 6 NE2 ? A HIS 30 ? A HIS 392 ? 1_555 ZN ? B ZN . ? A ZN 1001 ? 1_555 NE2 ? A HIS 36 ? A HIS 398 ? 1_555 109.6 ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 1001 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 1001' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 17 ? CYS A 379 . ? 1_555 ? 2 AC1 4 CYS A 23 ? CYS A 385 . ? 1_555 ? 3 AC1 4 HIS A 30 ? HIS A 392 . ? 1_555 ? 4 AC1 4 HIS A 36 ? HIS A 398 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 5 O A THR 377 ? ? H A SER 397 ? ? 1.55 2 13 O A THR 377 ? ? H A SER 397 ? ? 1.60 3 17 O A THR 377 ? ? H A SER 397 ? ? 1.58 4 18 O A THR 377 ? ? H A SER 397 ? ? 1.59 5 21 O A THR 377 ? ? H A SER 397 ? ? 1.58 6 22 O A THR 377 ? ? H A SER 397 ? ? 1.56 7 23 O A THR 377 ? ? H A SER 397 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 365 ? ? 53.01 95.34 2 1 SER A 369 ? ? -142.16 48.23 3 1 ASN A 372 ? ? -148.94 -66.85 4 1 GLN A 408 ? ? -105.04 58.05 5 1 ILE A 409 ? ? 50.67 74.93 6 1 VAL A 410 ? ? -119.83 72.06 7 1 GLN A 412 ? ? 53.64 76.96 8 1 THR A 415 ? ? -117.22 66.86 9 2 SER A 367 ? ? 52.53 83.20 10 2 GLU A 370 ? ? -116.10 52.24 11 2 ASN A 372 ? ? -145.46 -59.34 12 2 LYS A 373 ? ? -141.30 53.57 13 2 SER A 378 ? ? -49.98 154.27 14 2 CYS A 385 ? ? -58.92 80.26 15 2 PRO A 390 ? ? -66.00 -72.99 16 2 VAL A 407 ? ? 32.59 59.80 17 2 ILE A 409 ? ? -101.61 62.28 18 2 VAL A 410 ? ? -113.59 76.81 19 2 ASP A 413 ? ? -149.54 35.04 20 2 THR A 415 ? ? -115.64 66.92 21 3 SER A 367 ? ? -138.06 -65.14 22 3 ASN A 372 ? ? -148.47 -67.09 23 3 CYS A 385 ? ? -58.28 82.23 24 3 VAL A 410 ? ? -113.21 69.76 25 3 GLU A 414 ? ? -144.77 40.09 26 4 ASN A 372 ? ? -133.42 -60.95 27 4 CYS A 379 ? ? -34.94 148.69 28 4 VAL A 407 ? ? -106.78 62.77 29 4 ILE A 409 ? ? -105.44 67.28 30 4 VAL A 410 ? ? -117.43 67.85 31 4 ASP A 413 ? ? -152.52 48.96 32 4 THR A 415 ? ? -113.59 67.32 33 5 LEU A 365 ? ? -121.45 -62.21 34 5 SER A 367 ? ? -138.52 -61.35 35 5 ASN A 372 ? ? -119.65 64.88 36 5 CYS A 385 ? ? -45.56 83.92 37 5 LYS A 388 ? ? -155.86 83.90 38 5 PRO A 390 ? ? -68.98 -72.87 39 5 ILE A 409 ? ? -118.87 70.55 40 5 THR A 415 ? ? -114.31 65.62 41 6 SER A 369 ? ? -135.89 -59.51 42 6 ASN A 372 ? ? -146.58 -66.19 43 6 LYS A 373 ? ? -152.94 74.32 44 6 PRO A 390 ? ? -72.11 -72.86 45 6 VAL A 407 ? ? 52.30 85.82 46 6 GLN A 408 ? ? -166.04 79.54 47 6 THR A 415 ? ? -111.43 64.57 48 7 LEU A 365 ? ? -140.03 48.00 49 7 ASN A 372 ? ? -143.92 -67.19 50 7 LYS A 373 ? ? -169.25 76.93 51 7 ARG A 376 ? ? -57.94 174.18 52 7 CYS A 385 ? ? -55.87 85.79 53 7 ILE A 409 ? ? -107.43 73.50 54 7 VAL A 410 ? ? -115.90 79.73 55 7 ASP A 413 ? ? -150.76 35.46 56 7 GLU A 414 ? ? -141.75 54.23 57 8 SER A 367 ? ? -137.41 -60.26 58 8 ASN A 372 ? ? -146.30 -67.11 59 8 PRO A 390 ? ? -69.91 -73.46 60 8 GLN A 408 ? ? -155.81 88.15 61 8 ILE A 409 ? ? -100.21 69.84 62 8 VAL A 410 ? ? -119.74 74.47 63 8 ASP A 413 ? ? -148.33 34.70 64 9 ASN A 372 ? ? -132.16 -65.21 65 9 LYS A 373 ? ? -151.27 71.96 66 9 SER A 378 ? ? -49.29 160.20 67 9 ILE A 409 ? ? 51.62 70.19 68 9 THR A 415 ? ? -116.24 66.36 69 10 SER A 367 ? ? -129.57 -65.58 70 10 ASN A 372 ? ? -125.52 -58.63 71 10 ARG A 387 ? ? -48.72 163.82 72 10 PRO A 390 ? ? -73.94 -73.48 73 10 ILE A 409 ? ? -111.28 71.08 74 10 VAL A 410 ? ? -115.40 77.15 75 10 ASP A 413 ? ? -148.28 34.43 76 10 GLU A 414 ? ? -140.01 53.98 77 10 THR A 415 ? ? -112.52 66.38 78 11 LEU A 365 ? ? 52.77 80.58 79 11 SER A 367 ? ? -142.78 46.42 80 11 ASN A 372 ? ? -128.35 -59.99 81 11 CYS A 385 ? ? -57.42 84.94 82 11 VAL A 407 ? ? -109.26 70.55 83 11 ILE A 409 ? ? -106.44 67.94 84 11 VAL A 410 ? ? -113.82 66.12 85 11 GLU A 414 ? ? -148.93 49.41 86 11 THR A 415 ? ? -113.19 66.46 87 11 ASP A 416 ? ? -143.18 40.34 88 12 ASN A 372 ? ? -135.40 -64.81 89 12 LYS A 373 ? ? -140.07 47.71 90 12 CYS A 385 ? ? -59.38 81.83 91 12 VAL A 407 ? ? 44.76 89.31 92 12 ILE A 409 ? ? -111.21 74.25 93 13 LEU A 365 ? ? -140.71 -59.94 94 13 SER A 369 ? ? -142.24 39.14 95 13 CYS A 385 ? ? -49.39 152.57 96 13 ARG A 387 ? ? 23.61 107.54 97 13 ILE A 409 ? ? -108.50 77.15 98 13 VAL A 410 ? ? -115.83 78.25 99 13 THR A 415 ? ? -113.41 66.46 100 14 ASN A 372 ? ? -147.78 -66.64 101 14 PRO A 390 ? ? -70.03 -70.17 102 14 VAL A 391 ? ? -38.18 -31.81 103 14 VAL A 410 ? ? -118.55 57.97 104 14 GLN A 412 ? ? 65.30 -65.96 105 14 ASP A 413 ? ? -147.12 39.01 106 15 ASN A 372 ? ? -146.93 -67.63 107 15 LYS A 373 ? ? -156.80 74.86 108 15 ILE A 409 ? ? -103.65 70.62 109 15 GLN A 412 ? ? 77.34 -60.65 110 15 GLU A 414 ? ? -142.53 52.40 111 15 THR A 415 ? ? -113.41 66.29 112 16 ASN A 372 ? ? -145.28 -67.33 113 16 ARG A 376 ? ? -54.61 -179.25 114 16 CYS A 379 ? ? -36.37 151.64 115 16 PRO A 390 ? ? -71.31 -73.88 116 16 TYR A 404 ? ? -39.79 124.50 117 16 VAL A 407 ? ? -118.96 69.31 118 17 ILE A 409 ? ? -103.94 75.34 119 17 VAL A 410 ? ? -116.92 78.72 120 17 ASP A 413 ? ? -153.38 37.04 121 17 GLU A 414 ? ? -117.04 51.69 122 17 THR A 415 ? ? -117.39 66.13 123 18 LEU A 365 ? ? -132.86 -61.98 124 18 SER A 367 ? ? -141.20 47.27 125 18 SER A 369 ? ? -141.93 39.55 126 18 ILE A 409 ? ? -101.13 67.65 127 18 VAL A 410 ? ? -114.14 78.21 128 18 ASP A 413 ? ? -146.76 36.94 129 19 ASN A 372 ? ? -149.04 59.42 130 19 LYS A 375 ? ? -68.48 82.99 131 19 GLN A 408 ? ? -155.63 85.86 132 19 ILE A 409 ? ? -111.66 72.56 133 19 VAL A 410 ? ? -113.27 79.39 134 19 ASP A 413 ? ? -143.42 39.32 135 19 THR A 415 ? ? -112.98 65.22 136 20 ASN A 372 ? ? -135.61 -61.16 137 20 GLN A 408 ? ? -66.46 78.92 138 20 GLU A 414 ? ? -140.99 54.29 139 20 THR A 415 ? ? -111.96 66.43 140 21 ASN A 372 ? ? -146.07 53.67 141 21 VAL A 407 ? ? -111.21 61.85 142 21 VAL A 410 ? ? -117.48 69.27 143 21 THR A 415 ? ? -113.55 66.57 144 22 GLU A 370 ? ? -142.62 44.10 145 22 ASN A 372 ? ? -126.96 -59.11 146 22 PRO A 390 ? ? -72.47 -71.53 147 22 GLN A 408 ? ? -157.43 87.11 148 22 THR A 415 ? ? -110.25 65.82 149 23 SER A 367 ? ? -131.87 -65.33 150 23 ASN A 372 ? ? -126.38 -60.07 151 23 CYS A 385 ? ? -49.63 151.72 152 23 ARG A 387 ? ? -55.97 173.81 153 23 LYS A 388 ? ? -143.70 55.88 154 23 TYR A 404 ? ? -39.47 129.55 155 23 ILE A 409 ? ? -108.87 71.45 156 24 LYS A 375 ? ? -69.84 91.38 157 24 GLN A 408 ? ? -102.04 53.70 158 24 VAL A 410 ? ? -107.64 65.35 159 24 THR A 415 ? ? -114.00 65.10 160 25 SER A 369 ? ? -122.67 -65.77 161 25 ASN A 372 ? ? -126.21 -59.62 162 25 ILE A 409 ? ? -110.96 72.54 163 25 VAL A 410 ? ? -118.07 67.45 164 25 ASP A 413 ? ? -155.55 39.40 165 25 THR A 415 ? ? -114.83 66.50 # _pdbx_entry_details.entry_id 2KQB _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details 'RESIDUES 418-451 ARE NOT SHOWN IN THE COORDINATES BECAUSE STRUCTURE CALCULATIONS WERE CARRIED OUT ON RESIDUES 363-417 ONLY.' _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest ? # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 25 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KQB _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 6.5 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.57 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method XPLOR-NIH # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KQB _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;20 mM potassium pyrophosphate, 200 mM sodium chloride, 100 uM zinc sulphate, 2 mM [U-2H] DTT, 0.5-0.6 mM [U-98% 13C; U-98% 15N] APLF_363-451, 95% H2O/5% D2O ; 1 '95% H2O/5% D2O' ;20 mM potassium pyrophosphate, 200 mM sodium chloride, 100 uM zinc sulphate, 2 mM [U-2H] DTT, 0.5-0.6 mM [U-98% 13C; U-98% 15N] APLF_363-451, 100% D2O ; 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'potassium pyrophosphate-1' 20 ? mM ? 1 'sodium chloride-2' 200 ? mM ? 1 'zinc sulphate-3' 100 ? uM ? 1 DTT-4 2 ? mM '[U-2H]' 1 APLF_363-451-5 ? 0.5-0.6 mM '[U-98% 13C; U-98% 15N]' 1 'potassium pyrophosphate-6' 20 ? mM ? 2 'sodium chloride-7' 200 ? mM ? 2 'zinc sulphate-8' 100 ? uM ? 2 DTT-9 2 ? mM '[U-2H]' 2 APLF_363-451-10 ? 0.5-0.6 mM '[U-98% 13C; U-98% 15N]' 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.4 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-15N HMQC long-range' 1 3 1 '2D 1H-13C HSQC full-width' 1 4 1 '2D 1H-13C HSQC aliphatic' 1 5 1 '2D 1H-13C HSQC aromatic' 1 6 1 '2D 1H-1H NOESY' 1 7 1 '2D 1H-1H NOESY filtered' 1 8 1 '3D CBCANH' 1 9 1 '3D CBCA(CO)NH' 1 10 1 '3D HBHANH' 1 11 1 '3D HBHA(CO)NH' 1 12 1 '3D HCCH-TOCSY' 1 13 1 '3D HCCH-TOCSY' 1 14 1 '3D 1H-15N NOESY' 1 15 1 '3D 1H-13C NOESY' 1 16 1 '3D HNHB' 1 17 2 '3D HACAHB-COSY' # _pdbx_nmr_details.entry_id 2KQB _pdbx_nmr_details.text ;The author states that NMR was carried out on a single fragment (363-451) containing both fingers F1 and F2 of APLF, but the structure calculations were carried out separately for each finger. This co-ordinate file includes residues 363-417 and contains F1 as well as the unstructured regions on either side. ; # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2KQB _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total ? _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count ? _pdbx_nmr_constraints.NOE_long_range_total_count ? _pdbx_nmr_constraints.NOE_medium_range_total_count ? _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count ? _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 11 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 12 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 13 # _pdbx_nmr_refine.entry_id 2KQB _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' XPLOR-NIH ? 1 Goddard 'chemical shift assignment' Sparky ? 2 CCPN 'chemical shift assignment' CCPN_analysis ? 3 'Schwieters, Kuszewski, Tjandra and Clore' refinement XPLOR-NIH ? 4 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ARG 418 ? A ARG 56 2 1 Y 1 A PRO 419 ? A PRO 57 3 1 Y 1 A GLU 420 ? A GLU 58 4 1 Y 1 A CYS 421 ? A CYS 59 5 1 Y 1 A PRO 422 ? A PRO 60 6 1 Y 1 A TYR 423 ? A TYR 61 7 1 Y 1 A GLY 424 ? A GLY 62 8 1 Y 1 A PRO 425 ? A PRO 63 9 1 Y 1 A SER 426 ? A SER 64 10 1 Y 1 A CYS 427 ? A CYS 65 11 1 Y 1 A TYR 428 ? A TYR 66 12 1 Y 1 A ARG 429 ? A ARG 67 13 1 Y 1 A LYS 430 ? A LYS 68 14 1 Y 1 A ASN 431 ? A ASN 69 15 1 Y 1 A PRO 432 ? A PRO 70 16 1 Y 1 A GLN 433 ? A GLN 71 17 1 Y 1 A HIS 434 ? A HIS 72 18 1 Y 1 A LYS 435 ? A LYS 73 19 1 Y 1 A ILE 436 ? A ILE 74 20 1 Y 1 A GLU 437 ? A GLU 75 21 1 Y 1 A TYR 438 ? A TYR 76 22 1 Y 1 A ARG 439 ? A ARG 77 23 1 Y 1 A HIS 440 ? A HIS 78 24 1 Y 1 A ASN 441 ? A ASN 79 25 1 Y 1 A THR 442 ? A THR 80 26 1 Y 1 A LEU 443 ? A LEU 81 27 1 Y 1 A PRO 444 ? A PRO 82 28 1 Y 1 A VAL 445 ? A VAL 83 29 1 Y 1 A ARG 446 ? A ARG 84 30 1 Y 1 A ASN 447 ? A ASN 85 31 1 Y 1 A VAL 448 ? A VAL 86 32 1 Y 1 A LEU 449 ? A LEU 87 33 1 Y 1 A ASP 450 ? A ASP 88 34 1 Y 1 A GLU 451 ? A GLU 89 35 2 Y 1 A ARG 418 ? A ARG 56 36 2 Y 1 A PRO 419 ? A PRO 57 37 2 Y 1 A GLU 420 ? A GLU 58 38 2 Y 1 A CYS 421 ? A CYS 59 39 2 Y 1 A PRO 422 ? A PRO 60 40 2 Y 1 A TYR 423 ? A TYR 61 41 2 Y 1 A GLY 424 ? A GLY 62 42 2 Y 1 A PRO 425 ? A PRO 63 43 2 Y 1 A SER 426 ? A SER 64 44 2 Y 1 A CYS 427 ? A CYS 65 45 2 Y 1 A TYR 428 ? A TYR 66 46 2 Y 1 A ARG 429 ? A ARG 67 47 2 Y 1 A LYS 430 ? A LYS 68 48 2 Y 1 A ASN 431 ? A ASN 69 49 2 Y 1 A PRO 432 ? A PRO 70 50 2 Y 1 A GLN 433 ? A GLN 71 51 2 Y 1 A HIS 434 ? A HIS 72 52 2 Y 1 A LYS 435 ? A LYS 73 53 2 Y 1 A ILE 436 ? A ILE 74 54 2 Y 1 A GLU 437 ? A GLU 75 55 2 Y 1 A TYR 438 ? A TYR 76 56 2 Y 1 A ARG 439 ? A ARG 77 57 2 Y 1 A HIS 440 ? A HIS 78 58 2 Y 1 A ASN 441 ? A ASN 79 59 2 Y 1 A THR 442 ? A THR 80 60 2 Y 1 A LEU 443 ? A LEU 81 61 2 Y 1 A PRO 444 ? A PRO 82 62 2 Y 1 A VAL 445 ? A VAL 83 63 2 Y 1 A ARG 446 ? A ARG 84 64 2 Y 1 A ASN 447 ? A ASN 85 65 2 Y 1 A VAL 448 ? A VAL 86 66 2 Y 1 A LEU 449 ? A LEU 87 67 2 Y 1 A ASP 450 ? A ASP 88 68 2 Y 1 A GLU 451 ? A GLU 89 69 3 Y 1 A ARG 418 ? A ARG 56 70 3 Y 1 A PRO 419 ? A PRO 57 71 3 Y 1 A GLU 420 ? A GLU 58 72 3 Y 1 A CYS 421 ? A CYS 59 73 3 Y 1 A PRO 422 ? A PRO 60 74 3 Y 1 A TYR 423 ? A TYR 61 75 3 Y 1 A GLY 424 ? A GLY 62 76 3 Y 1 A PRO 425 ? A PRO 63 77 3 Y 1 A SER 426 ? A SER 64 78 3 Y 1 A CYS 427 ? A CYS 65 79 3 Y 1 A TYR 428 ? A TYR 66 80 3 Y 1 A ARG 429 ? A ARG 67 81 3 Y 1 A LYS 430 ? A LYS 68 82 3 Y 1 A ASN 431 ? A ASN 69 83 3 Y 1 A PRO 432 ? A PRO 70 84 3 Y 1 A GLN 433 ? A GLN 71 85 3 Y 1 A HIS 434 ? A HIS 72 86 3 Y 1 A LYS 435 ? A LYS 73 87 3 Y 1 A ILE 436 ? A ILE 74 88 3 Y 1 A GLU 437 ? A GLU 75 89 3 Y 1 A TYR 438 ? A TYR 76 90 3 Y 1 A ARG 439 ? A ARG 77 91 3 Y 1 A HIS 440 ? A HIS 78 92 3 Y 1 A ASN 441 ? A ASN 79 93 3 Y 1 A THR 442 ? A THR 80 94 3 Y 1 A LEU 443 ? A LEU 81 95 3 Y 1 A PRO 444 ? A PRO 82 96 3 Y 1 A VAL 445 ? A VAL 83 97 3 Y 1 A ARG 446 ? A ARG 84 98 3 Y 1 A ASN 447 ? A ASN 85 99 3 Y 1 A VAL 448 ? A VAL 86 100 3 Y 1 A LEU 449 ? A LEU 87 101 3 Y 1 A ASP 450 ? A ASP 88 102 3 Y 1 A GLU 451 ? A GLU 89 103 4 Y 1 A ARG 418 ? A ARG 56 104 4 Y 1 A PRO 419 ? A PRO 57 105 4 Y 1 A GLU 420 ? A GLU 58 106 4 Y 1 A CYS 421 ? A CYS 59 107 4 Y 1 A PRO 422 ? A PRO 60 108 4 Y 1 A TYR 423 ? A TYR 61 109 4 Y 1 A GLY 424 ? A GLY 62 110 4 Y 1 A PRO 425 ? A PRO 63 111 4 Y 1 A SER 426 ? A SER 64 112 4 Y 1 A CYS 427 ? A CYS 65 113 4 Y 1 A TYR 428 ? A TYR 66 114 4 Y 1 A ARG 429 ? A ARG 67 115 4 Y 1 A LYS 430 ? A LYS 68 116 4 Y 1 A ASN 431 ? A ASN 69 117 4 Y 1 A PRO 432 ? A PRO 70 118 4 Y 1 A GLN 433 ? A GLN 71 119 4 Y 1 A HIS 434 ? A HIS 72 120 4 Y 1 A LYS 435 ? A LYS 73 121 4 Y 1 A ILE 436 ? A ILE 74 122 4 Y 1 A GLU 437 ? A GLU 75 123 4 Y 1 A TYR 438 ? A TYR 76 124 4 Y 1 A ARG 439 ? A ARG 77 125 4 Y 1 A HIS 440 ? A HIS 78 126 4 Y 1 A ASN 441 ? A ASN 79 127 4 Y 1 A THR 442 ? A THR 80 128 4 Y 1 A LEU 443 ? A LEU 81 129 4 Y 1 A PRO 444 ? A PRO 82 130 4 Y 1 A VAL 445 ? A VAL 83 131 4 Y 1 A ARG 446 ? A ARG 84 132 4 Y 1 A ASN 447 ? A ASN 85 133 4 Y 1 A VAL 448 ? A VAL 86 134 4 Y 1 A LEU 449 ? A LEU 87 135 4 Y 1 A ASP 450 ? A ASP 88 136 4 Y 1 A GLU 451 ? A GLU 89 137 5 Y 1 A ARG 418 ? A ARG 56 138 5 Y 1 A PRO 419 ? A PRO 57 139 5 Y 1 A GLU 420 ? A GLU 58 140 5 Y 1 A CYS 421 ? A CYS 59 141 5 Y 1 A PRO 422 ? A PRO 60 142 5 Y 1 A TYR 423 ? A TYR 61 143 5 Y 1 A GLY 424 ? A GLY 62 144 5 Y 1 A PRO 425 ? A PRO 63 145 5 Y 1 A SER 426 ? A SER 64 146 5 Y 1 A CYS 427 ? A CYS 65 147 5 Y 1 A TYR 428 ? A TYR 66 148 5 Y 1 A ARG 429 ? A ARG 67 149 5 Y 1 A LYS 430 ? A LYS 68 150 5 Y 1 A ASN 431 ? A ASN 69 151 5 Y 1 A PRO 432 ? A PRO 70 152 5 Y 1 A GLN 433 ? A GLN 71 153 5 Y 1 A HIS 434 ? A HIS 72 154 5 Y 1 A LYS 435 ? A LYS 73 155 5 Y 1 A ILE 436 ? A ILE 74 156 5 Y 1 A GLU 437 ? A GLU 75 157 5 Y 1 A TYR 438 ? A TYR 76 158 5 Y 1 A ARG 439 ? A ARG 77 159 5 Y 1 A HIS 440 ? A HIS 78 160 5 Y 1 A ASN 441 ? A ASN 79 161 5 Y 1 A THR 442 ? A THR 80 162 5 Y 1 A LEU 443 ? A LEU 81 163 5 Y 1 A PRO 444 ? A PRO 82 164 5 Y 1 A VAL 445 ? A VAL 83 165 5 Y 1 A ARG 446 ? A ARG 84 166 5 Y 1 A ASN 447 ? A ASN 85 167 5 Y 1 A VAL 448 ? A VAL 86 168 5 Y 1 A LEU 449 ? A LEU 87 169 5 Y 1 A ASP 450 ? A ASP 88 170 5 Y 1 A GLU 451 ? A GLU 89 171 6 Y 1 A ARG 418 ? A ARG 56 172 6 Y 1 A PRO 419 ? A PRO 57 173 6 Y 1 A GLU 420 ? A GLU 58 174 6 Y 1 A CYS 421 ? A CYS 59 175 6 Y 1 A PRO 422 ? A PRO 60 176 6 Y 1 A TYR 423 ? A TYR 61 177 6 Y 1 A GLY 424 ? A GLY 62 178 6 Y 1 A PRO 425 ? A PRO 63 179 6 Y 1 A SER 426 ? A SER 64 180 6 Y 1 A CYS 427 ? A CYS 65 181 6 Y 1 A TYR 428 ? A TYR 66 182 6 Y 1 A ARG 429 ? A ARG 67 183 6 Y 1 A LYS 430 ? A LYS 68 184 6 Y 1 A ASN 431 ? A ASN 69 185 6 Y 1 A PRO 432 ? A PRO 70 186 6 Y 1 A GLN 433 ? A GLN 71 187 6 Y 1 A HIS 434 ? A HIS 72 188 6 Y 1 A LYS 435 ? A LYS 73 189 6 Y 1 A ILE 436 ? A ILE 74 190 6 Y 1 A GLU 437 ? A GLU 75 191 6 Y 1 A TYR 438 ? A TYR 76 192 6 Y 1 A ARG 439 ? A ARG 77 193 6 Y 1 A HIS 440 ? A HIS 78 194 6 Y 1 A ASN 441 ? A ASN 79 195 6 Y 1 A THR 442 ? A THR 80 196 6 Y 1 A LEU 443 ? A LEU 81 197 6 Y 1 A PRO 444 ? A PRO 82 198 6 Y 1 A VAL 445 ? A VAL 83 199 6 Y 1 A ARG 446 ? A ARG 84 200 6 Y 1 A ASN 447 ? A ASN 85 201 6 Y 1 A VAL 448 ? A VAL 86 202 6 Y 1 A LEU 449 ? A LEU 87 203 6 Y 1 A ASP 450 ? A ASP 88 204 6 Y 1 A GLU 451 ? A GLU 89 205 7 Y 1 A ARG 418 ? A ARG 56 206 7 Y 1 A PRO 419 ? A PRO 57 207 7 Y 1 A GLU 420 ? A GLU 58 208 7 Y 1 A CYS 421 ? A CYS 59 209 7 Y 1 A PRO 422 ? A PRO 60 210 7 Y 1 A TYR 423 ? A TYR 61 211 7 Y 1 A GLY 424 ? A GLY 62 212 7 Y 1 A PRO 425 ? A PRO 63 213 7 Y 1 A SER 426 ? A SER 64 214 7 Y 1 A CYS 427 ? A CYS 65 215 7 Y 1 A TYR 428 ? A TYR 66 216 7 Y 1 A ARG 429 ? A ARG 67 217 7 Y 1 A LYS 430 ? A LYS 68 218 7 Y 1 A ASN 431 ? A ASN 69 219 7 Y 1 A PRO 432 ? A PRO 70 220 7 Y 1 A GLN 433 ? A GLN 71 221 7 Y 1 A HIS 434 ? A HIS 72 222 7 Y 1 A LYS 435 ? A LYS 73 223 7 Y 1 A ILE 436 ? A ILE 74 224 7 Y 1 A GLU 437 ? A GLU 75 225 7 Y 1 A TYR 438 ? A TYR 76 226 7 Y 1 A ARG 439 ? A ARG 77 227 7 Y 1 A HIS 440 ? A HIS 78 228 7 Y 1 A ASN 441 ? A ASN 79 229 7 Y 1 A THR 442 ? A THR 80 230 7 Y 1 A LEU 443 ? A LEU 81 231 7 Y 1 A PRO 444 ? A PRO 82 232 7 Y 1 A VAL 445 ? A VAL 83 233 7 Y 1 A ARG 446 ? A ARG 84 234 7 Y 1 A ASN 447 ? A ASN 85 235 7 Y 1 A VAL 448 ? A VAL 86 236 7 Y 1 A LEU 449 ? A LEU 87 237 7 Y 1 A ASP 450 ? A ASP 88 238 7 Y 1 A GLU 451 ? A GLU 89 239 8 Y 1 A ARG 418 ? A ARG 56 240 8 Y 1 A PRO 419 ? A PRO 57 241 8 Y 1 A GLU 420 ? A GLU 58 242 8 Y 1 A CYS 421 ? A CYS 59 243 8 Y 1 A PRO 422 ? A PRO 60 244 8 Y 1 A TYR 423 ? A TYR 61 245 8 Y 1 A GLY 424 ? A GLY 62 246 8 Y 1 A PRO 425 ? A PRO 63 247 8 Y 1 A SER 426 ? A SER 64 248 8 Y 1 A CYS 427 ? A CYS 65 249 8 Y 1 A TYR 428 ? A TYR 66 250 8 Y 1 A ARG 429 ? A ARG 67 251 8 Y 1 A LYS 430 ? A LYS 68 252 8 Y 1 A ASN 431 ? A ASN 69 253 8 Y 1 A PRO 432 ? A PRO 70 254 8 Y 1 A GLN 433 ? A GLN 71 255 8 Y 1 A HIS 434 ? A HIS 72 256 8 Y 1 A LYS 435 ? A LYS 73 257 8 Y 1 A ILE 436 ? A ILE 74 258 8 Y 1 A GLU 437 ? A GLU 75 259 8 Y 1 A TYR 438 ? A TYR 76 260 8 Y 1 A ARG 439 ? A ARG 77 261 8 Y 1 A HIS 440 ? A HIS 78 262 8 Y 1 A ASN 441 ? A ASN 79 263 8 Y 1 A THR 442 ? A THR 80 264 8 Y 1 A LEU 443 ? A LEU 81 265 8 Y 1 A PRO 444 ? A PRO 82 266 8 Y 1 A VAL 445 ? A VAL 83 267 8 Y 1 A ARG 446 ? A ARG 84 268 8 Y 1 A ASN 447 ? A ASN 85 269 8 Y 1 A VAL 448 ? A VAL 86 270 8 Y 1 A LEU 449 ? A LEU 87 271 8 Y 1 A ASP 450 ? A ASP 88 272 8 Y 1 A GLU 451 ? A GLU 89 273 9 Y 1 A ARG 418 ? A ARG 56 274 9 Y 1 A PRO 419 ? A PRO 57 275 9 Y 1 A GLU 420 ? A GLU 58 276 9 Y 1 A CYS 421 ? A CYS 59 277 9 Y 1 A PRO 422 ? A PRO 60 278 9 Y 1 A TYR 423 ? A TYR 61 279 9 Y 1 A GLY 424 ? A GLY 62 280 9 Y 1 A PRO 425 ? A PRO 63 281 9 Y 1 A SER 426 ? A SER 64 282 9 Y 1 A CYS 427 ? A CYS 65 283 9 Y 1 A TYR 428 ? A TYR 66 284 9 Y 1 A ARG 429 ? A ARG 67 285 9 Y 1 A LYS 430 ? A LYS 68 286 9 Y 1 A ASN 431 ? A ASN 69 287 9 Y 1 A PRO 432 ? A PRO 70 288 9 Y 1 A GLN 433 ? A GLN 71 289 9 Y 1 A HIS 434 ? A HIS 72 290 9 Y 1 A LYS 435 ? A LYS 73 291 9 Y 1 A ILE 436 ? A ILE 74 292 9 Y 1 A GLU 437 ? A GLU 75 293 9 Y 1 A TYR 438 ? A TYR 76 294 9 Y 1 A ARG 439 ? A ARG 77 295 9 Y 1 A HIS 440 ? A HIS 78 296 9 Y 1 A ASN 441 ? A ASN 79 297 9 Y 1 A THR 442 ? A THR 80 298 9 Y 1 A LEU 443 ? A LEU 81 299 9 Y 1 A PRO 444 ? A PRO 82 300 9 Y 1 A VAL 445 ? A VAL 83 301 9 Y 1 A ARG 446 ? A ARG 84 302 9 Y 1 A ASN 447 ? A ASN 85 303 9 Y 1 A VAL 448 ? A VAL 86 304 9 Y 1 A LEU 449 ? A LEU 87 305 9 Y 1 A ASP 450 ? A ASP 88 306 9 Y 1 A GLU 451 ? A GLU 89 307 10 Y 1 A ARG 418 ? A ARG 56 308 10 Y 1 A PRO 419 ? A PRO 57 309 10 Y 1 A GLU 420 ? A GLU 58 310 10 Y 1 A CYS 421 ? A CYS 59 311 10 Y 1 A PRO 422 ? A PRO 60 312 10 Y 1 A TYR 423 ? A TYR 61 313 10 Y 1 A GLY 424 ? A GLY 62 314 10 Y 1 A PRO 425 ? A PRO 63 315 10 Y 1 A SER 426 ? A SER 64 316 10 Y 1 A CYS 427 ? A CYS 65 317 10 Y 1 A TYR 428 ? A TYR 66 318 10 Y 1 A ARG 429 ? A ARG 67 319 10 Y 1 A LYS 430 ? A LYS 68 320 10 Y 1 A ASN 431 ? A ASN 69 321 10 Y 1 A PRO 432 ? A PRO 70 322 10 Y 1 A GLN 433 ? A GLN 71 323 10 Y 1 A HIS 434 ? A HIS 72 324 10 Y 1 A LYS 435 ? A LYS 73 325 10 Y 1 A ILE 436 ? A ILE 74 326 10 Y 1 A GLU 437 ? A GLU 75 327 10 Y 1 A TYR 438 ? A TYR 76 328 10 Y 1 A ARG 439 ? A ARG 77 329 10 Y 1 A HIS 440 ? A HIS 78 330 10 Y 1 A ASN 441 ? A ASN 79 331 10 Y 1 A THR 442 ? A THR 80 332 10 Y 1 A LEU 443 ? A LEU 81 333 10 Y 1 A PRO 444 ? A PRO 82 334 10 Y 1 A VAL 445 ? A VAL 83 335 10 Y 1 A ARG 446 ? A ARG 84 336 10 Y 1 A ASN 447 ? A ASN 85 337 10 Y 1 A VAL 448 ? A VAL 86 338 10 Y 1 A LEU 449 ? A LEU 87 339 10 Y 1 A ASP 450 ? A ASP 88 340 10 Y 1 A GLU 451 ? A GLU 89 341 11 Y 1 A ARG 418 ? A ARG 56 342 11 Y 1 A PRO 419 ? A PRO 57 343 11 Y 1 A GLU 420 ? A GLU 58 344 11 Y 1 A CYS 421 ? A CYS 59 345 11 Y 1 A PRO 422 ? A PRO 60 346 11 Y 1 A TYR 423 ? A TYR 61 347 11 Y 1 A GLY 424 ? A GLY 62 348 11 Y 1 A PRO 425 ? A PRO 63 349 11 Y 1 A SER 426 ? A SER 64 350 11 Y 1 A CYS 427 ? A CYS 65 351 11 Y 1 A TYR 428 ? A TYR 66 352 11 Y 1 A ARG 429 ? A ARG 67 353 11 Y 1 A LYS 430 ? A LYS 68 354 11 Y 1 A ASN 431 ? A ASN 69 355 11 Y 1 A PRO 432 ? A PRO 70 356 11 Y 1 A GLN 433 ? A GLN 71 357 11 Y 1 A HIS 434 ? A HIS 72 358 11 Y 1 A LYS 435 ? A LYS 73 359 11 Y 1 A ILE 436 ? A ILE 74 360 11 Y 1 A GLU 437 ? A GLU 75 361 11 Y 1 A TYR 438 ? A TYR 76 362 11 Y 1 A ARG 439 ? A ARG 77 363 11 Y 1 A HIS 440 ? A HIS 78 364 11 Y 1 A ASN 441 ? A ASN 79 365 11 Y 1 A THR 442 ? A THR 80 366 11 Y 1 A LEU 443 ? A LEU 81 367 11 Y 1 A PRO 444 ? A PRO 82 368 11 Y 1 A VAL 445 ? A VAL 83 369 11 Y 1 A ARG 446 ? A ARG 84 370 11 Y 1 A ASN 447 ? A ASN 85 371 11 Y 1 A VAL 448 ? A VAL 86 372 11 Y 1 A LEU 449 ? A LEU 87 373 11 Y 1 A ASP 450 ? A ASP 88 374 11 Y 1 A GLU 451 ? A GLU 89 375 12 Y 1 A ARG 418 ? A ARG 56 376 12 Y 1 A PRO 419 ? A PRO 57 377 12 Y 1 A GLU 420 ? A GLU 58 378 12 Y 1 A CYS 421 ? A CYS 59 379 12 Y 1 A PRO 422 ? A PRO 60 380 12 Y 1 A TYR 423 ? A TYR 61 381 12 Y 1 A GLY 424 ? A GLY 62 382 12 Y 1 A PRO 425 ? A PRO 63 383 12 Y 1 A SER 426 ? A SER 64 384 12 Y 1 A CYS 427 ? A CYS 65 385 12 Y 1 A TYR 428 ? A TYR 66 386 12 Y 1 A ARG 429 ? A ARG 67 387 12 Y 1 A LYS 430 ? A LYS 68 388 12 Y 1 A ASN 431 ? A ASN 69 389 12 Y 1 A PRO 432 ? A PRO 70 390 12 Y 1 A GLN 433 ? A GLN 71 391 12 Y 1 A HIS 434 ? A HIS 72 392 12 Y 1 A LYS 435 ? A LYS 73 393 12 Y 1 A ILE 436 ? A ILE 74 394 12 Y 1 A GLU 437 ? A GLU 75 395 12 Y 1 A TYR 438 ? A TYR 76 396 12 Y 1 A ARG 439 ? A ARG 77 397 12 Y 1 A HIS 440 ? A HIS 78 398 12 Y 1 A ASN 441 ? A ASN 79 399 12 Y 1 A THR 442 ? A THR 80 400 12 Y 1 A LEU 443 ? A LEU 81 401 12 Y 1 A PRO 444 ? A PRO 82 402 12 Y 1 A VAL 445 ? A VAL 83 403 12 Y 1 A ARG 446 ? A ARG 84 404 12 Y 1 A ASN 447 ? A ASN 85 405 12 Y 1 A VAL 448 ? A VAL 86 406 12 Y 1 A LEU 449 ? A LEU 87 407 12 Y 1 A ASP 450 ? A ASP 88 408 12 Y 1 A GLU 451 ? A GLU 89 409 13 Y 1 A ARG 418 ? A ARG 56 410 13 Y 1 A PRO 419 ? A PRO 57 411 13 Y 1 A GLU 420 ? A GLU 58 412 13 Y 1 A CYS 421 ? A CYS 59 413 13 Y 1 A PRO 422 ? A PRO 60 414 13 Y 1 A TYR 423 ? A TYR 61 415 13 Y 1 A GLY 424 ? A GLY 62 416 13 Y 1 A PRO 425 ? A PRO 63 417 13 Y 1 A SER 426 ? A SER 64 418 13 Y 1 A CYS 427 ? A CYS 65 419 13 Y 1 A TYR 428 ? A TYR 66 420 13 Y 1 A ARG 429 ? A ARG 67 421 13 Y 1 A LYS 430 ? A LYS 68 422 13 Y 1 A ASN 431 ? A ASN 69 423 13 Y 1 A PRO 432 ? A PRO 70 424 13 Y 1 A GLN 433 ? A GLN 71 425 13 Y 1 A HIS 434 ? A HIS 72 426 13 Y 1 A LYS 435 ? A LYS 73 427 13 Y 1 A ILE 436 ? A ILE 74 428 13 Y 1 A GLU 437 ? A GLU 75 429 13 Y 1 A TYR 438 ? A TYR 76 430 13 Y 1 A ARG 439 ? A ARG 77 431 13 Y 1 A HIS 440 ? A HIS 78 432 13 Y 1 A ASN 441 ? A ASN 79 433 13 Y 1 A THR 442 ? A THR 80 434 13 Y 1 A LEU 443 ? A LEU 81 435 13 Y 1 A PRO 444 ? A PRO 82 436 13 Y 1 A VAL 445 ? A VAL 83 437 13 Y 1 A ARG 446 ? A ARG 84 438 13 Y 1 A ASN 447 ? A ASN 85 439 13 Y 1 A VAL 448 ? A VAL 86 440 13 Y 1 A LEU 449 ? A LEU 87 441 13 Y 1 A ASP 450 ? A ASP 88 442 13 Y 1 A GLU 451 ? A GLU 89 443 14 Y 1 A ARG 418 ? A ARG 56 444 14 Y 1 A PRO 419 ? A PRO 57 445 14 Y 1 A GLU 420 ? A GLU 58 446 14 Y 1 A CYS 421 ? A CYS 59 447 14 Y 1 A PRO 422 ? A PRO 60 448 14 Y 1 A TYR 423 ? A TYR 61 449 14 Y 1 A GLY 424 ? A GLY 62 450 14 Y 1 A PRO 425 ? A PRO 63 451 14 Y 1 A SER 426 ? A SER 64 452 14 Y 1 A CYS 427 ? A CYS 65 453 14 Y 1 A TYR 428 ? A TYR 66 454 14 Y 1 A ARG 429 ? A ARG 67 455 14 Y 1 A LYS 430 ? A LYS 68 456 14 Y 1 A ASN 431 ? A ASN 69 457 14 Y 1 A PRO 432 ? A PRO 70 458 14 Y 1 A GLN 433 ? A GLN 71 459 14 Y 1 A HIS 434 ? A HIS 72 460 14 Y 1 A LYS 435 ? A LYS 73 461 14 Y 1 A ILE 436 ? A ILE 74 462 14 Y 1 A GLU 437 ? A GLU 75 463 14 Y 1 A TYR 438 ? A TYR 76 464 14 Y 1 A ARG 439 ? A ARG 77 465 14 Y 1 A HIS 440 ? A HIS 78 466 14 Y 1 A ASN 441 ? A ASN 79 467 14 Y 1 A THR 442 ? A THR 80 468 14 Y 1 A LEU 443 ? A LEU 81 469 14 Y 1 A PRO 444 ? A PRO 82 470 14 Y 1 A VAL 445 ? A VAL 83 471 14 Y 1 A ARG 446 ? A ARG 84 472 14 Y 1 A ASN 447 ? A ASN 85 473 14 Y 1 A VAL 448 ? A VAL 86 474 14 Y 1 A LEU 449 ? A LEU 87 475 14 Y 1 A ASP 450 ? A ASP 88 476 14 Y 1 A GLU 451 ? A GLU 89 477 15 Y 1 A ARG 418 ? A ARG 56 478 15 Y 1 A PRO 419 ? A PRO 57 479 15 Y 1 A GLU 420 ? A GLU 58 480 15 Y 1 A CYS 421 ? A CYS 59 481 15 Y 1 A PRO 422 ? A PRO 60 482 15 Y 1 A TYR 423 ? A TYR 61 483 15 Y 1 A GLY 424 ? A GLY 62 484 15 Y 1 A PRO 425 ? A PRO 63 485 15 Y 1 A SER 426 ? A SER 64 486 15 Y 1 A CYS 427 ? A CYS 65 487 15 Y 1 A TYR 428 ? A TYR 66 488 15 Y 1 A ARG 429 ? A ARG 67 489 15 Y 1 A LYS 430 ? A LYS 68 490 15 Y 1 A ASN 431 ? A ASN 69 491 15 Y 1 A PRO 432 ? A PRO 70 492 15 Y 1 A GLN 433 ? A GLN 71 493 15 Y 1 A HIS 434 ? A HIS 72 494 15 Y 1 A LYS 435 ? A LYS 73 495 15 Y 1 A ILE 436 ? A ILE 74 496 15 Y 1 A GLU 437 ? A GLU 75 497 15 Y 1 A TYR 438 ? A TYR 76 498 15 Y 1 A ARG 439 ? A ARG 77 499 15 Y 1 A HIS 440 ? A HIS 78 500 15 Y 1 A ASN 441 ? A ASN 79 501 15 Y 1 A THR 442 ? A THR 80 502 15 Y 1 A LEU 443 ? A LEU 81 503 15 Y 1 A PRO 444 ? A PRO 82 504 15 Y 1 A VAL 445 ? A VAL 83 505 15 Y 1 A ARG 446 ? A ARG 84 506 15 Y 1 A ASN 447 ? A ASN 85 507 15 Y 1 A VAL 448 ? A VAL 86 508 15 Y 1 A LEU 449 ? A LEU 87 509 15 Y 1 A ASP 450 ? A ASP 88 510 15 Y 1 A GLU 451 ? A GLU 89 511 16 Y 1 A ARG 418 ? A ARG 56 512 16 Y 1 A PRO 419 ? A PRO 57 513 16 Y 1 A GLU 420 ? A GLU 58 514 16 Y 1 A CYS 421 ? A CYS 59 515 16 Y 1 A PRO 422 ? A PRO 60 516 16 Y 1 A TYR 423 ? A TYR 61 517 16 Y 1 A GLY 424 ? A GLY 62 518 16 Y 1 A PRO 425 ? A PRO 63 519 16 Y 1 A SER 426 ? A SER 64 520 16 Y 1 A CYS 427 ? A CYS 65 521 16 Y 1 A TYR 428 ? A TYR 66 522 16 Y 1 A ARG 429 ? A ARG 67 523 16 Y 1 A LYS 430 ? A LYS 68 524 16 Y 1 A ASN 431 ? A ASN 69 525 16 Y 1 A PRO 432 ? A PRO 70 526 16 Y 1 A GLN 433 ? A GLN 71 527 16 Y 1 A HIS 434 ? A HIS 72 528 16 Y 1 A LYS 435 ? A LYS 73 529 16 Y 1 A ILE 436 ? A ILE 74 530 16 Y 1 A GLU 437 ? A GLU 75 531 16 Y 1 A TYR 438 ? A TYR 76 532 16 Y 1 A ARG 439 ? A ARG 77 533 16 Y 1 A HIS 440 ? A HIS 78 534 16 Y 1 A ASN 441 ? A ASN 79 535 16 Y 1 A THR 442 ? A THR 80 536 16 Y 1 A LEU 443 ? A LEU 81 537 16 Y 1 A PRO 444 ? A PRO 82 538 16 Y 1 A VAL 445 ? A VAL 83 539 16 Y 1 A ARG 446 ? A ARG 84 540 16 Y 1 A ASN 447 ? A ASN 85 541 16 Y 1 A VAL 448 ? A VAL 86 542 16 Y 1 A LEU 449 ? A LEU 87 543 16 Y 1 A ASP 450 ? A ASP 88 544 16 Y 1 A GLU 451 ? A GLU 89 545 17 Y 1 A ARG 418 ? A ARG 56 546 17 Y 1 A PRO 419 ? A PRO 57 547 17 Y 1 A GLU 420 ? A GLU 58 548 17 Y 1 A CYS 421 ? A CYS 59 549 17 Y 1 A PRO 422 ? A PRO 60 550 17 Y 1 A TYR 423 ? A TYR 61 551 17 Y 1 A GLY 424 ? A GLY 62 552 17 Y 1 A PRO 425 ? A PRO 63 553 17 Y 1 A SER 426 ? A SER 64 554 17 Y 1 A CYS 427 ? A CYS 65 555 17 Y 1 A TYR 428 ? A TYR 66 556 17 Y 1 A ARG 429 ? A ARG 67 557 17 Y 1 A LYS 430 ? A LYS 68 558 17 Y 1 A ASN 431 ? A ASN 69 559 17 Y 1 A PRO 432 ? A PRO 70 560 17 Y 1 A GLN 433 ? A GLN 71 561 17 Y 1 A HIS 434 ? A HIS 72 562 17 Y 1 A LYS 435 ? A LYS 73 563 17 Y 1 A ILE 436 ? A ILE 74 564 17 Y 1 A GLU 437 ? A GLU 75 565 17 Y 1 A TYR 438 ? A TYR 76 566 17 Y 1 A ARG 439 ? A ARG 77 567 17 Y 1 A HIS 440 ? A HIS 78 568 17 Y 1 A ASN 441 ? A ASN 79 569 17 Y 1 A THR 442 ? A THR 80 570 17 Y 1 A LEU 443 ? A LEU 81 571 17 Y 1 A PRO 444 ? A PRO 82 572 17 Y 1 A VAL 445 ? A VAL 83 573 17 Y 1 A ARG 446 ? A ARG 84 574 17 Y 1 A ASN 447 ? A ASN 85 575 17 Y 1 A VAL 448 ? A VAL 86 576 17 Y 1 A LEU 449 ? A LEU 87 577 17 Y 1 A ASP 450 ? A ASP 88 578 17 Y 1 A GLU 451 ? A GLU 89 579 18 Y 1 A ARG 418 ? A ARG 56 580 18 Y 1 A PRO 419 ? A PRO 57 581 18 Y 1 A GLU 420 ? A GLU 58 582 18 Y 1 A CYS 421 ? A CYS 59 583 18 Y 1 A PRO 422 ? A PRO 60 584 18 Y 1 A TYR 423 ? A TYR 61 585 18 Y 1 A GLY 424 ? A GLY 62 586 18 Y 1 A PRO 425 ? A PRO 63 587 18 Y 1 A SER 426 ? A SER 64 588 18 Y 1 A CYS 427 ? A CYS 65 589 18 Y 1 A TYR 428 ? A TYR 66 590 18 Y 1 A ARG 429 ? A ARG 67 591 18 Y 1 A LYS 430 ? A LYS 68 592 18 Y 1 A ASN 431 ? A ASN 69 593 18 Y 1 A PRO 432 ? A PRO 70 594 18 Y 1 A GLN 433 ? A GLN 71 595 18 Y 1 A HIS 434 ? A HIS 72 596 18 Y 1 A LYS 435 ? A LYS 73 597 18 Y 1 A ILE 436 ? A ILE 74 598 18 Y 1 A GLU 437 ? A GLU 75 599 18 Y 1 A TYR 438 ? A TYR 76 600 18 Y 1 A ARG 439 ? A ARG 77 601 18 Y 1 A HIS 440 ? A HIS 78 602 18 Y 1 A ASN 441 ? A ASN 79 603 18 Y 1 A THR 442 ? A THR 80 604 18 Y 1 A LEU 443 ? A LEU 81 605 18 Y 1 A PRO 444 ? A PRO 82 606 18 Y 1 A VAL 445 ? A VAL 83 607 18 Y 1 A ARG 446 ? A ARG 84 608 18 Y 1 A ASN 447 ? A ASN 85 609 18 Y 1 A VAL 448 ? A VAL 86 610 18 Y 1 A LEU 449 ? A LEU 87 611 18 Y 1 A ASP 450 ? A ASP 88 612 18 Y 1 A GLU 451 ? A GLU 89 613 19 Y 1 A ARG 418 ? A ARG 56 614 19 Y 1 A PRO 419 ? A PRO 57 615 19 Y 1 A GLU 420 ? A GLU 58 616 19 Y 1 A CYS 421 ? A CYS 59 617 19 Y 1 A PRO 422 ? A PRO 60 618 19 Y 1 A TYR 423 ? A TYR 61 619 19 Y 1 A GLY 424 ? A GLY 62 620 19 Y 1 A PRO 425 ? A PRO 63 621 19 Y 1 A SER 426 ? A SER 64 622 19 Y 1 A CYS 427 ? A CYS 65 623 19 Y 1 A TYR 428 ? A TYR 66 624 19 Y 1 A ARG 429 ? A ARG 67 625 19 Y 1 A LYS 430 ? A LYS 68 626 19 Y 1 A ASN 431 ? A ASN 69 627 19 Y 1 A PRO 432 ? A PRO 70 628 19 Y 1 A GLN 433 ? A GLN 71 629 19 Y 1 A HIS 434 ? A HIS 72 630 19 Y 1 A LYS 435 ? A LYS 73 631 19 Y 1 A ILE 436 ? A ILE 74 632 19 Y 1 A GLU 437 ? A GLU 75 633 19 Y 1 A TYR 438 ? A TYR 76 634 19 Y 1 A ARG 439 ? A ARG 77 635 19 Y 1 A HIS 440 ? A HIS 78 636 19 Y 1 A ASN 441 ? A ASN 79 637 19 Y 1 A THR 442 ? A THR 80 638 19 Y 1 A LEU 443 ? A LEU 81 639 19 Y 1 A PRO 444 ? A PRO 82 640 19 Y 1 A VAL 445 ? A VAL 83 641 19 Y 1 A ARG 446 ? A ARG 84 642 19 Y 1 A ASN 447 ? A ASN 85 643 19 Y 1 A VAL 448 ? A VAL 86 644 19 Y 1 A LEU 449 ? A LEU 87 645 19 Y 1 A ASP 450 ? A ASP 88 646 19 Y 1 A GLU 451 ? A GLU 89 647 20 Y 1 A ARG 418 ? A ARG 56 648 20 Y 1 A PRO 419 ? A PRO 57 649 20 Y 1 A GLU 420 ? A GLU 58 650 20 Y 1 A CYS 421 ? A CYS 59 651 20 Y 1 A PRO 422 ? A PRO 60 652 20 Y 1 A TYR 423 ? A TYR 61 653 20 Y 1 A GLY 424 ? A GLY 62 654 20 Y 1 A PRO 425 ? A PRO 63 655 20 Y 1 A SER 426 ? A SER 64 656 20 Y 1 A CYS 427 ? A CYS 65 657 20 Y 1 A TYR 428 ? A TYR 66 658 20 Y 1 A ARG 429 ? A ARG 67 659 20 Y 1 A LYS 430 ? A LYS 68 660 20 Y 1 A ASN 431 ? A ASN 69 661 20 Y 1 A PRO 432 ? A PRO 70 662 20 Y 1 A GLN 433 ? A GLN 71 663 20 Y 1 A HIS 434 ? A HIS 72 664 20 Y 1 A LYS 435 ? A LYS 73 665 20 Y 1 A ILE 436 ? A ILE 74 666 20 Y 1 A GLU 437 ? A GLU 75 667 20 Y 1 A TYR 438 ? A TYR 76 668 20 Y 1 A ARG 439 ? A ARG 77 669 20 Y 1 A HIS 440 ? A HIS 78 670 20 Y 1 A ASN 441 ? A ASN 79 671 20 Y 1 A THR 442 ? A THR 80 672 20 Y 1 A LEU 443 ? A LEU 81 673 20 Y 1 A PRO 444 ? A PRO 82 674 20 Y 1 A VAL 445 ? A VAL 83 675 20 Y 1 A ARG 446 ? A ARG 84 676 20 Y 1 A ASN 447 ? A ASN 85 677 20 Y 1 A VAL 448 ? A VAL 86 678 20 Y 1 A LEU 449 ? A LEU 87 679 20 Y 1 A ASP 450 ? A ASP 88 680 20 Y 1 A GLU 451 ? A GLU 89 681 21 Y 1 A ARG 418 ? A ARG 56 682 21 Y 1 A PRO 419 ? A PRO 57 683 21 Y 1 A GLU 420 ? A GLU 58 684 21 Y 1 A CYS 421 ? A CYS 59 685 21 Y 1 A PRO 422 ? A PRO 60 686 21 Y 1 A TYR 423 ? A TYR 61 687 21 Y 1 A GLY 424 ? A GLY 62 688 21 Y 1 A PRO 425 ? A PRO 63 689 21 Y 1 A SER 426 ? A SER 64 690 21 Y 1 A CYS 427 ? A CYS 65 691 21 Y 1 A TYR 428 ? A TYR 66 692 21 Y 1 A ARG 429 ? A ARG 67 693 21 Y 1 A LYS 430 ? A LYS 68 694 21 Y 1 A ASN 431 ? A ASN 69 695 21 Y 1 A PRO 432 ? A PRO 70 696 21 Y 1 A GLN 433 ? A GLN 71 697 21 Y 1 A HIS 434 ? A HIS 72 698 21 Y 1 A LYS 435 ? A LYS 73 699 21 Y 1 A ILE 436 ? A ILE 74 700 21 Y 1 A GLU 437 ? A GLU 75 701 21 Y 1 A TYR 438 ? A TYR 76 702 21 Y 1 A ARG 439 ? A ARG 77 703 21 Y 1 A HIS 440 ? A HIS 78 704 21 Y 1 A ASN 441 ? A ASN 79 705 21 Y 1 A THR 442 ? A THR 80 706 21 Y 1 A LEU 443 ? A LEU 81 707 21 Y 1 A PRO 444 ? A PRO 82 708 21 Y 1 A VAL 445 ? A VAL 83 709 21 Y 1 A ARG 446 ? A ARG 84 710 21 Y 1 A ASN 447 ? A ASN 85 711 21 Y 1 A VAL 448 ? A VAL 86 712 21 Y 1 A LEU 449 ? A LEU 87 713 21 Y 1 A ASP 450 ? A ASP 88 714 21 Y 1 A GLU 451 ? A GLU 89 715 22 Y 1 A ARG 418 ? A ARG 56 716 22 Y 1 A PRO 419 ? A PRO 57 717 22 Y 1 A GLU 420 ? A GLU 58 718 22 Y 1 A CYS 421 ? A CYS 59 719 22 Y 1 A PRO 422 ? A PRO 60 720 22 Y 1 A TYR 423 ? A TYR 61 721 22 Y 1 A GLY 424 ? A GLY 62 722 22 Y 1 A PRO 425 ? A PRO 63 723 22 Y 1 A SER 426 ? A SER 64 724 22 Y 1 A CYS 427 ? A CYS 65 725 22 Y 1 A TYR 428 ? A TYR 66 726 22 Y 1 A ARG 429 ? A ARG 67 727 22 Y 1 A LYS 430 ? A LYS 68 728 22 Y 1 A ASN 431 ? A ASN 69 729 22 Y 1 A PRO 432 ? A PRO 70 730 22 Y 1 A GLN 433 ? A GLN 71 731 22 Y 1 A HIS 434 ? A HIS 72 732 22 Y 1 A LYS 435 ? A LYS 73 733 22 Y 1 A ILE 436 ? A ILE 74 734 22 Y 1 A GLU 437 ? A GLU 75 735 22 Y 1 A TYR 438 ? A TYR 76 736 22 Y 1 A ARG 439 ? A ARG 77 737 22 Y 1 A HIS 440 ? A HIS 78 738 22 Y 1 A ASN 441 ? A ASN 79 739 22 Y 1 A THR 442 ? A THR 80 740 22 Y 1 A LEU 443 ? A LEU 81 741 22 Y 1 A PRO 444 ? A PRO 82 742 22 Y 1 A VAL 445 ? A VAL 83 743 22 Y 1 A ARG 446 ? A ARG 84 744 22 Y 1 A ASN 447 ? A ASN 85 745 22 Y 1 A VAL 448 ? A VAL 86 746 22 Y 1 A LEU 449 ? A LEU 87 747 22 Y 1 A ASP 450 ? A ASP 88 748 22 Y 1 A GLU 451 ? A GLU 89 749 23 Y 1 A ARG 418 ? A ARG 56 750 23 Y 1 A PRO 419 ? A PRO 57 751 23 Y 1 A GLU 420 ? A GLU 58 752 23 Y 1 A CYS 421 ? A CYS 59 753 23 Y 1 A PRO 422 ? A PRO 60 754 23 Y 1 A TYR 423 ? A TYR 61 755 23 Y 1 A GLY 424 ? A GLY 62 756 23 Y 1 A PRO 425 ? A PRO 63 757 23 Y 1 A SER 426 ? A SER 64 758 23 Y 1 A CYS 427 ? A CYS 65 759 23 Y 1 A TYR 428 ? A TYR 66 760 23 Y 1 A ARG 429 ? A ARG 67 761 23 Y 1 A LYS 430 ? A LYS 68 762 23 Y 1 A ASN 431 ? A ASN 69 763 23 Y 1 A PRO 432 ? A PRO 70 764 23 Y 1 A GLN 433 ? A GLN 71 765 23 Y 1 A HIS 434 ? A HIS 72 766 23 Y 1 A LYS 435 ? A LYS 73 767 23 Y 1 A ILE 436 ? A ILE 74 768 23 Y 1 A GLU 437 ? A GLU 75 769 23 Y 1 A TYR 438 ? A TYR 76 770 23 Y 1 A ARG 439 ? A ARG 77 771 23 Y 1 A HIS 440 ? A HIS 78 772 23 Y 1 A ASN 441 ? A ASN 79 773 23 Y 1 A THR 442 ? A THR 80 774 23 Y 1 A LEU 443 ? A LEU 81 775 23 Y 1 A PRO 444 ? A PRO 82 776 23 Y 1 A VAL 445 ? A VAL 83 777 23 Y 1 A ARG 446 ? A ARG 84 778 23 Y 1 A ASN 447 ? A ASN 85 779 23 Y 1 A VAL 448 ? A VAL 86 780 23 Y 1 A LEU 449 ? A LEU 87 781 23 Y 1 A ASP 450 ? A ASP 88 782 23 Y 1 A GLU 451 ? A GLU 89 783 24 Y 1 A ARG 418 ? A ARG 56 784 24 Y 1 A PRO 419 ? A PRO 57 785 24 Y 1 A GLU 420 ? A GLU 58 786 24 Y 1 A CYS 421 ? A CYS 59 787 24 Y 1 A PRO 422 ? A PRO 60 788 24 Y 1 A TYR 423 ? A TYR 61 789 24 Y 1 A GLY 424 ? A GLY 62 790 24 Y 1 A PRO 425 ? A PRO 63 791 24 Y 1 A SER 426 ? A SER 64 792 24 Y 1 A CYS 427 ? A CYS 65 793 24 Y 1 A TYR 428 ? A TYR 66 794 24 Y 1 A ARG 429 ? A ARG 67 795 24 Y 1 A LYS 430 ? A LYS 68 796 24 Y 1 A ASN 431 ? A ASN 69 797 24 Y 1 A PRO 432 ? A PRO 70 798 24 Y 1 A GLN 433 ? A GLN 71 799 24 Y 1 A HIS 434 ? A HIS 72 800 24 Y 1 A LYS 435 ? A LYS 73 801 24 Y 1 A ILE 436 ? A ILE 74 802 24 Y 1 A GLU 437 ? A GLU 75 803 24 Y 1 A TYR 438 ? A TYR 76 804 24 Y 1 A ARG 439 ? A ARG 77 805 24 Y 1 A HIS 440 ? A HIS 78 806 24 Y 1 A ASN 441 ? A ASN 79 807 24 Y 1 A THR 442 ? A THR 80 808 24 Y 1 A LEU 443 ? A LEU 81 809 24 Y 1 A PRO 444 ? A PRO 82 810 24 Y 1 A VAL 445 ? A VAL 83 811 24 Y 1 A ARG 446 ? A ARG 84 812 24 Y 1 A ASN 447 ? A ASN 85 813 24 Y 1 A VAL 448 ? A VAL 86 814 24 Y 1 A LEU 449 ? A LEU 87 815 24 Y 1 A ASP 450 ? A ASP 88 816 24 Y 1 A GLU 451 ? A GLU 89 817 25 Y 1 A ARG 418 ? A ARG 56 818 25 Y 1 A PRO 419 ? A PRO 57 819 25 Y 1 A GLU 420 ? A GLU 58 820 25 Y 1 A CYS 421 ? A CYS 59 821 25 Y 1 A PRO 422 ? A PRO 60 822 25 Y 1 A TYR 423 ? A TYR 61 823 25 Y 1 A GLY 424 ? A GLY 62 824 25 Y 1 A PRO 425 ? A PRO 63 825 25 Y 1 A SER 426 ? A SER 64 826 25 Y 1 A CYS 427 ? A CYS 65 827 25 Y 1 A TYR 428 ? A TYR 66 828 25 Y 1 A ARG 429 ? A ARG 67 829 25 Y 1 A LYS 430 ? A LYS 68 830 25 Y 1 A ASN 431 ? A ASN 69 831 25 Y 1 A PRO 432 ? A PRO 70 832 25 Y 1 A GLN 433 ? A GLN 71 833 25 Y 1 A HIS 434 ? A HIS 72 834 25 Y 1 A LYS 435 ? A LYS 73 835 25 Y 1 A ILE 436 ? A ILE 74 836 25 Y 1 A GLU 437 ? A GLU 75 837 25 Y 1 A TYR 438 ? A TYR 76 838 25 Y 1 A ARG 439 ? A ARG 77 839 25 Y 1 A HIS 440 ? A HIS 78 840 25 Y 1 A ASN 441 ? A ASN 79 841 25 Y 1 A THR 442 ? A THR 80 842 25 Y 1 A LEU 443 ? A LEU 81 843 25 Y 1 A PRO 444 ? A PRO 82 844 25 Y 1 A VAL 445 ? A VAL 83 845 25 Y 1 A ARG 446 ? A ARG 84 846 25 Y 1 A ASN 447 ? A ASN 85 847 25 Y 1 A VAL 448 ? A VAL 86 848 25 Y 1 A LEU 449 ? A LEU 87 849 25 Y 1 A ASP 450 ? A ASP 88 850 25 Y 1 A GLU 451 ? A GLU 89 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 ZN ZN ZN N N 361 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Bruker DMX 2 'Bruker DMX' 500 Bruker DRX 3 'Bruker DRX' # _atom_sites.entry_id 2KQB _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_