data_2KVC # _entry.id 2KVC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2KVC RCSB RCSB101618 WWPDB D_1000101618 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id MytuD.17112.a _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KVC _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-03-12 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Buchko, G.W.' 1 'Kim, C.Y.' 2 'Terwilliger, T.C.' 3 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' 4 # _citation.id primary _citation.title 'Inaugural structure from the DUF3349 superfamily of proteins, Mycobacterium tuberculosis Rv0543c.' _citation.journal_abbrev Arch.Biochem.Biophys. _citation.journal_volume 506 _citation.page_first 150 _citation.page_last 156 _citation.year 2011 _citation.journal_id_ASTM ABBIA4 _citation.country US _citation.journal_id_ISSN 0003-9861 _citation.journal_id_CSD 0158 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21144816 _citation.pdbx_database_id_DOI 10.1016/j.abb.2010.12.001 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Buchko, G.W.' 1 primary 'Phan, I.' 2 primary 'Myler, P.J.' 3 primary 'Terwilliger, T.C.' 4 primary 'Kim, C.Y.' 5 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Putative uncharacterized protein' _entity.formula_weight 11608.073 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMNRFLTSIVAWLRAGYPEGIPPTDSFAVLALLCRRLSHDEVKAVANELMRLGDFDQIDIGVVITHFTDELPSPEDVE RVRARLAAQGWPLDDVRDREEHA ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMNRFLTSIVAWLRAGYPEGIPPTDSFAVLALLCRRLSHDEVKAVANELMRLGDFDQIDIGVVITHFTDELPSPEDVE RVRARLAAQGWPLDDVRDREEHA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier MytuD.17112.a # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ASN n 1 6 ARG n 1 7 PHE n 1 8 LEU n 1 9 THR n 1 10 SER n 1 11 ILE n 1 12 VAL n 1 13 ALA n 1 14 TRP n 1 15 LEU n 1 16 ARG n 1 17 ALA n 1 18 GLY n 1 19 TYR n 1 20 PRO n 1 21 GLU n 1 22 GLY n 1 23 ILE n 1 24 PRO n 1 25 PRO n 1 26 THR n 1 27 ASP n 1 28 SER n 1 29 PHE n 1 30 ALA n 1 31 VAL n 1 32 LEU n 1 33 ALA n 1 34 LEU n 1 35 LEU n 1 36 CYS n 1 37 ARG n 1 38 ARG n 1 39 LEU n 1 40 SER n 1 41 HIS n 1 42 ASP n 1 43 GLU n 1 44 VAL n 1 45 LYS n 1 46 ALA n 1 47 VAL n 1 48 ALA n 1 49 ASN n 1 50 GLU n 1 51 LEU n 1 52 MET n 1 53 ARG n 1 54 LEU n 1 55 GLY n 1 56 ASP n 1 57 PHE n 1 58 ASP n 1 59 GLN n 1 60 ILE n 1 61 ASP n 1 62 ILE n 1 63 GLY n 1 64 VAL n 1 65 VAL n 1 66 ILE n 1 67 THR n 1 68 HIS n 1 69 PHE n 1 70 THR n 1 71 ASP n 1 72 GLU n 1 73 LEU n 1 74 PRO n 1 75 SER n 1 76 PRO n 1 77 GLU n 1 78 ASP n 1 79 VAL n 1 80 GLU n 1 81 ARG n 1 82 VAL n 1 83 ARG n 1 84 ALA n 1 85 ARG n 1 86 LEU n 1 87 ALA n 1 88 ALA n 1 89 GLN n 1 90 GLY n 1 91 TRP n 1 92 PRO n 1 93 LEU n 1 94 ASP n 1 95 ASP n 1 96 VAL n 1 97 ARG n 1 98 ASP n 1 99 ARG n 1 100 GLU n 1 101 GLU n 1 102 HIS n 1 103 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MRA_0550, Rv0543c' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 25177 / H37Ra' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 419947 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21PRO _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A5TZS3_MYCTA _struct_ref.pdbx_db_accession A5TZS3 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNRFLTSIVAWLRAGYPEGIPPTDSFAVLALLCRRLSHDEVKAVANELMRLGDFDQIDIGVVITHFTDELPSPEDVERVR ARLAAQGWPLDDVRDREEHA ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KVC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 103 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A5TZS3 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 100 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 103 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KVC GLY A 1 ? UNP A5TZS3 ? ? 'EXPRESSION TAG' 1 1 1 2KVC SER A 2 ? UNP A5TZS3 ? ? 'EXPRESSION TAG' 2 2 1 2KVC HIS A 3 ? UNP A5TZS3 ? ? 'EXPRESSION TAG' 3 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCACB' 1 3 1 '3D C(CO)NH' 1 4 1 '3D HN(COCA)CB' 1 5 1 '3D HNCO' 1 6 1 '2D 1H-13C HSQC' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-13C NOESY' 1 9 2 '2D 1H-15N HSQC' 1 10 1 '3D H(CCO)NH' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 300 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1-2 mM Rv0543c, 300 mM sodium chloride, 20 mM TRIS, 1 mM DTT, 93% H2O/7% D2O' 1 '93% H2O/7% D2O' '1-2 mM Rv0543c, 300 mM sodium chloride, 20 mM TRIS, 1 mM DTT, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 750 Varian INOVA 2 'Varian INOVA' 500 Varian UNITYPLUS 3 'Varian UnityPlus' # _pdbx_nmr_refine.entry_id 2KVC _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ;STRUCTURE DETERMINATION WAS PERFORMED ITERATIVELY USING CYANA (AUTOMATED NOESY ASSIGNMENTS). A TOTAL OF 20 STRUCTURES OUT OF 100 WITH LOWEST TARGET FUNCTION FROM THE FINAL CYANA CALCULATION WERE TAKEN AND REFINED BY RESTRAINED MOLECULAR DYNAMICS/ENERGY MINIMIZATION IN EXPLICIT WATER (CNS)AFTER ADDING 1% TO THE UPPER BOUNDARY LIMIT OF THE DISTANCE RESTRAINTS. FROM THIS SET OF 20 STRUCTURES 15 STRUCTURES WITH THE FEWEST/FURTHEST CLOSE CONTACTS WERE SELECTED AND SUBMITTED. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KVC _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KVC _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, P. et al.' 'structure solution' CYANA 2.1 1 'Accelrys Software Inc.' processing Felix 2007 2 'Goddard, T. et al.' 'data analysis' SPARKY 3.115 3 'Bhattacharya, A. et al.' 'data analysis' PSVS 1.1 4 'Brunger, A. et al.' refinement CNS 1.1 5 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KVC _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KVC _struct.title ;Solution structure of the Mycobacterium tuberculosis protein Rv0543c, a member of the DUF3349 superfamily. Seattle Structural Genomics Center for Infectious Disease target MytuD.17112.a ; _struct.pdbx_descriptor 'Putative uncharacterized protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KVC _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' _struct_keywords.text 'tuberculosis, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 HIS A 3 ? TYR A 19 ? HIS A 3 TYR A 19 1 ? 17 HELX_P HELX_P2 2 PRO A 24 ? CYS A 36 ? PRO A 24 CYS A 36 1 ? 13 HELX_P HELX_P3 3 SER A 40 ? GLY A 55 ? SER A 40 GLY A 55 1 ? 16 HELX_P HELX_P4 4 ASP A 61 ? HIS A 68 ? ASP A 61 HIS A 68 1 ? 8 HELX_P HELX_P5 5 SER A 75 ? ALA A 87 ? SER A 75 ALA A 87 1 ? 13 HELX_P HELX_P6 6 ALA A 88 ? GLY A 90 ? ALA A 88 GLY A 90 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LEU 73 A . ? LEU 73 A PRO 74 A ? PRO 74 A 1 1.90 2 LEU 73 A . ? LEU 73 A PRO 74 A ? PRO 74 A 2 1.47 3 LEU 73 A . ? LEU 73 A PRO 74 A ? PRO 74 A 3 3.06 4 LEU 73 A . ? LEU 73 A PRO 74 A ? PRO 74 A 4 0.11 5 LEU 73 A . ? LEU 73 A PRO 74 A ? PRO 74 A 5 -1.72 6 LEU 73 A . ? LEU 73 A PRO 74 A ? PRO 74 A 6 3.00 7 LEU 73 A . ? LEU 73 A PRO 74 A ? PRO 74 A 7 3.50 8 LEU 73 A . ? LEU 73 A PRO 74 A ? PRO 74 A 8 0.05 9 LEU 73 A . ? LEU 73 A PRO 74 A ? PRO 74 A 9 0.72 10 LEU 73 A . ? LEU 73 A PRO 74 A ? PRO 74 A 10 -3.18 11 LEU 73 A . ? LEU 73 A PRO 74 A ? PRO 74 A 11 -0.27 12 LEU 73 A . ? LEU 73 A PRO 74 A ? PRO 74 A 12 -0.03 13 LEU 73 A . ? LEU 73 A PRO 74 A ? PRO 74 A 13 0.63 14 LEU 73 A . ? LEU 73 A PRO 74 A ? PRO 74 A 14 1.83 15 LEU 73 A . ? LEU 73 A PRO 74 A ? PRO 74 A 15 -0.08 # _atom_sites.entry_id 2KVC _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 TRP 14 14 14 TRP TRP A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 MET 52 52 52 MET MET A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 TRP 91 91 91 TRP TRP A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 HIS 102 102 102 HIS HIS A . n A 1 103 ALA 103 103 103 ALA ALA A . n # _pdbx_SG_project.full_name_of_center 'Seattle Structural Genomics Center for Infectious Disease' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center SSGCID _pdbx_SG_project.project_name ? # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-03-23 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id Rv0543c ? 1-2 mM ? 1 'sodium chloride' 300 ? mM ? 1 TRIS 20 ? mM ? 1 DTT 1 ? mM ? 1 Rv0543c ? 1-2 mM ? 2 'sodium chloride' 300 ? mM ? 2 TRIS 20 ? mM ? 2 DTT 1 ? mM ? 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2KVC _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 66 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1118 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 364 _pdbx_nmr_constraints.NOE_long_range_total_count 241 _pdbx_nmr_constraints.NOE_medium_range_total_count 209 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 304 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 132 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 66 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 66 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 6 HH12 A ARG 16 ? ? OD2 A ASP 56 ? ? 1.58 2 15 HG A SER 40 ? ? OE1 A GLU 43 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 56 ? ? -85.66 44.38 2 1 ILE A 60 ? ? -125.49 -166.95 3 1 ASP A 94 ? ? -111.65 -168.35 4 1 ARG A 99 ? ? -176.03 144.44 5 1 GLU A 101 ? ? -97.87 -65.05 6 2 TRP A 91 ? ? 65.24 95.11 7 2 LEU A 93 ? ? -90.74 51.96 8 2 VAL A 96 ? ? -58.36 109.25 9 2 GLU A 100 ? ? 57.40 74.79 10 3 ARG A 99 ? ? -126.13 -67.19 11 4 ASP A 56 ? ? -87.46 45.28 12 4 TRP A 91 ? ? -159.68 89.06 13 4 ASP A 94 ? ? -162.07 -157.85 14 4 ARG A 99 ? ? -166.66 -75.14 15 4 GLU A 100 ? ? 177.83 113.06 16 5 TRP A 91 ? ? -151.15 83.73 17 5 ASP A 94 ? ? 46.74 71.88 18 5 ARG A 99 ? ? -160.47 24.26 19 6 HIS A 68 ? ? -156.54 79.09 20 7 SER A 2 ? ? -135.79 -75.38 21 7 TRP A 91 ? ? -155.69 89.03 22 7 ASP A 95 ? ? -175.45 -168.02 23 7 ARG A 99 ? ? -156.73 57.49 24 7 HIS A 102 ? ? -164.47 101.79 25 8 ARG A 97 ? ? -112.17 -156.93 26 9 HIS A 68 ? ? -153.87 83.66 27 9 ARG A 99 ? ? -142.92 32.95 28 10 TRP A 91 ? ? 68.78 86.71 29 10 PRO A 92 ? ? -85.03 36.35 30 10 LEU A 93 ? ? -111.09 -70.22 31 11 ASP A 56 ? ? -86.76 39.24 32 11 GLN A 59 ? ? 63.03 92.84 33 11 ARG A 99 ? ? -144.32 17.96 34 12 PRO A 25 ? ? -68.07 29.89 35 12 PHE A 57 ? ? -153.03 -87.06 36 12 ASP A 58 ? ? 171.89 144.43 37 13 PRO A 92 ? ? -95.70 32.09 38 14 PHE A 57 ? ? -153.77 -88.46 39 14 ASP A 58 ? ? 171.71 121.87 40 14 LEU A 93 ? ? -90.27 36.98 #