data_2KWC # _entry.id 2KWC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KWC pdb_00002kwc 10.2210/pdb2kwc/pdb RCSB RCSB101654 ? ? BMRB 16835 ? ? WWPDB D_1000101654 ? ? # _pdbx_database_related.db_id 16835 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KWC _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2010-04-05 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kumeta, H.' 1 'Watanabe, M.' 2 'Nakatogawa, H.' 3 'Yamaguchi, M.' 4 'Ogura, K.' 5 'Adachi, W.' 6 'Fujioka, Y.' 7 'Noda, N.N.' 8 'Ohsumi, Y.' 9 'Inagaki, F.' 10 # _citation.id primary _citation.title 'The NMR structure of the autophagy-related protein Atg8' _citation.journal_abbrev J.Biomol.Nmr _citation.journal_volume 47 _citation.page_first 237 _citation.page_last 241 _citation.year 2010 _citation.journal_id_ASTM JBNME9 _citation.country NE _citation.journal_id_ISSN 0925-2738 _citation.journal_id_CSD 0800 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20428927 _citation.pdbx_database_id_DOI 10.1007/s10858-010-9420-1 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kumeta, H.' 1 ? primary 'Watanabe, M.' 2 ? primary 'Nakatogawa, H.' 3 ? primary 'Yamaguchi, M.' 4 ? primary 'Ogura, K.' 5 ? primary 'Adachi, W.' 6 ? primary 'Fujioka, Y.' 7 ? primary 'Noda, N.N.' 8 ? primary 'Ohsumi, Y.' 9 ? primary 'Inagaki, F.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Autophagy-related protein 8' _entity.formula_weight 13459.552 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation K26P _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Atg8, Autophagy-related ubiquitin-like modifier ATG8, Cytoplasm to vacuole targeting protein 5' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKSTFKSEYPFEKRKAESERIADRFPNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFV NDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFG ; _entity_poly.pdbx_seq_one_letter_code_can ;MKSTFKSEYPFEKRKAESERIADRFPNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFV NDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 SER n 1 4 THR n 1 5 PHE n 1 6 LYS n 1 7 SER n 1 8 GLU n 1 9 TYR n 1 10 PRO n 1 11 PHE n 1 12 GLU n 1 13 LYS n 1 14 ARG n 1 15 LYS n 1 16 ALA n 1 17 GLU n 1 18 SER n 1 19 GLU n 1 20 ARG n 1 21 ILE n 1 22 ALA n 1 23 ASP n 1 24 ARG n 1 25 PHE n 1 26 PRO n 1 27 ASN n 1 28 ARG n 1 29 ILE n 1 30 PRO n 1 31 VAL n 1 32 ILE n 1 33 CYS n 1 34 GLU n 1 35 LYS n 1 36 ALA n 1 37 GLU n 1 38 LYS n 1 39 SER n 1 40 ASP n 1 41 ILE n 1 42 PRO n 1 43 GLU n 1 44 ILE n 1 45 ASP n 1 46 LYS n 1 47 ARG n 1 48 LYS n 1 49 TYR n 1 50 LEU n 1 51 VAL n 1 52 PRO n 1 53 ALA n 1 54 ASP n 1 55 LEU n 1 56 THR n 1 57 VAL n 1 58 GLY n 1 59 GLN n 1 60 PHE n 1 61 VAL n 1 62 TYR n 1 63 VAL n 1 64 ILE n 1 65 ARG n 1 66 LYS n 1 67 ARG n 1 68 ILE n 1 69 MET n 1 70 LEU n 1 71 PRO n 1 72 PRO n 1 73 GLU n 1 74 LYS n 1 75 ALA n 1 76 ILE n 1 77 PHE n 1 78 ILE n 1 79 PHE n 1 80 VAL n 1 81 ASN n 1 82 ASP n 1 83 THR n 1 84 LEU n 1 85 PRO n 1 86 PRO n 1 87 THR n 1 88 ALA n 1 89 ALA n 1 90 LEU n 1 91 MET n 1 92 SER n 1 93 ALA n 1 94 ILE n 1 95 TYR n 1 96 GLN n 1 97 GLU n 1 98 HIS n 1 99 LYS n 1 100 ASP n 1 101 LYS n 1 102 ASP n 1 103 GLY n 1 104 PHE n 1 105 LEU n 1 106 TYR n 1 107 VAL n 1 108 THR n 1 109 TYR n 1 110 SER n 1 111 GLY n 1 112 GLU n 1 113 ASN n 1 114 THR n 1 115 PHE n 1 116 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;Baker's yeast ; _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pGEX6p _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ATG8_YEAST _struct_ref.pdbx_db_accession P38182 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFV NDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFG ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KWC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 116 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P38182 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 116 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 116 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2KWC _struct_ref_seq_dif.mon_id PRO _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 26 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P38182 _struct_ref_seq_dif.db_mon_id LYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 26 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 26 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D HN(CO)CA' 1 5 1 '3D HNCA' 1 6 1 '3D HBHA(CO)NH' 1 7 1 '3D HN(CA)HA' 1 8 1 '3D C(CO)NH' 1 9 1 '3D HCCH-TOCSY' 1 10 1 '3D CCH-TOCSY' 1 11 1 '2D HbCbCgCdHd' 1 12 1 '2D HbCbCgCdCeHe' 1 13 1 '3D 1H-15N NOESY' 1 14 1 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 170 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 297 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.6mM [U-99% 13C; U-99% 15N] Atg8 K26P; 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Varian INOVA 1 'Varian INOVA' 600 Varian INOVA 2 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2KWC _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KWC _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KWC _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal Varian collection VNMR 6.1C 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 5.0 2 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS 2007.068.09.07 3 Goddard 'chemical shift assignment' Sparky 3.113 4 Goddard 'peak picking' Sparky 3.113 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 6 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 2.1 7 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KWC _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KWC _struct.title 'The NMR structure of the autophagy-related protein Atg8' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KWC _struct_keywords.pdbx_keywords 'PROTEIN TRANSPORT' _struct_keywords.text 'Autophagy, Atg8, Protein Transport' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 10 ? PHE A 25 ? PRO A 10 PHE A 25 1 ? 16 HELX_P HELX_P2 2 THR A 56 ? ILE A 68 ? THR A 56 ILE A 68 1 ? 13 HELX_P HELX_P3 3 LEU A 90 ? LYS A 99 ? LEU A 90 LYS A 99 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 49 ? PRO A 52 ? TYR A 49 PRO A 52 A 2 ARG A 28 ? CYS A 33 ? ARG A 28 CYS A 33 A 3 LEU A 105 ? SER A 110 ? LEU A 105 SER A 110 A 4 PHE A 77 ? VAL A 80 ? PHE A 77 VAL A 80 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O TYR A 49 ? O TYR A 49 N VAL A 31 ? N VAL A 31 A 2 3 N ILE A 32 ? N ILE A 32 O VAL A 107 ? O VAL A 107 A 3 4 O THR A 108 ? O THR A 108 N PHE A 79 ? N PHE A 79 # _atom_sites.entry_id 2KWC _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 MET 69 69 69 MET MET A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 MET 91 91 91 MET MET A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 HIS 98 98 98 HIS HIS A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 PHE 104 104 104 PHE PHE A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 TYR 106 106 106 TYR TYR A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 TYR 109 109 109 TYR TYR A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 PHE 115 115 115 PHE PHE A . n A 1 116 GLY 116 116 116 GLY GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-05-12 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-26 4 'Structure model' 1 3 2021-11-10 5 'Structure model' 1 4 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' Other 5 4 'Structure model' 'Database references' 6 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_database_status 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' database_2 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 4 'Structure model' '_database_2.pdbx_DOI' 4 4 'Structure model' '_database_2.pdbx_database_accession' 5 4 'Structure model' '_struct_ref_seq_dif.details' 6 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_nmr_exptl_sample.component 'Atg8 K26P-1' _pdbx_nmr_exptl_sample.concentration 0.6 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-99% 13C; U-99% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 39 ? ? -50.72 176.68 2 1 GLU A 43 ? ? -53.93 170.88 3 1 PHE A 104 ? ? -51.84 177.95 4 2 PHE A 5 ? ? -37.79 -30.76 5 2 GLU A 17 ? ? -39.04 -30.08 6 2 SER A 39 ? ? -54.61 177.59 7 2 MET A 69 ? ? 39.61 54.13 8 2 PHE A 104 ? ? -47.17 175.01 9 3 SER A 7 ? ? -102.44 -67.29 10 3 GLU A 8 ? ? -38.92 -35.60 11 3 PHE A 11 ? ? -64.92 -72.00 12 3 GLU A 12 ? ? -38.98 -33.30 13 3 LYS A 13 ? ? -71.16 -70.77 14 3 ARG A 24 ? ? -100.74 -64.91 15 3 SER A 39 ? ? -64.29 -176.45 16 3 PHE A 104 ? ? -48.03 175.54 17 4 SER A 39 ? ? -58.18 179.07 18 4 GLU A 43 ? ? -54.38 170.93 19 4 PHE A 104 ? ? -58.61 170.88 20 4 SER A 110 ? ? -170.63 134.76 21 5 SER A 7 ? ? -100.48 -63.57 22 5 GLU A 8 ? ? -38.97 -34.19 23 5 SER A 39 ? ? -48.81 169.07 24 5 PHE A 104 ? ? -45.95 172.43 25 6 PHE A 5 ? ? -37.56 -30.88 26 6 SER A 39 ? ? -59.41 -179.57 27 6 GLU A 43 ? ? -57.29 170.93 28 6 PHE A 104 ? ? -50.70 177.53 29 6 ASN A 113 ? ? -91.54 46.00 30 7 PHE A 25 ? ? -118.49 78.95 31 7 SER A 39 ? ? -55.04 174.67 32 7 PHE A 104 ? ? -48.25 177.47 33 7 ASN A 113 ? ? -89.25 45.07 34 8 LYS A 2 ? ? -72.31 -78.81 35 8 LYS A 13 ? ? -42.51 -71.03 36 8 ARG A 24 ? ? -108.23 -61.04 37 8 ASN A 113 ? ? -90.71 45.98 38 9 SER A 7 ? ? -95.59 -67.50 39 9 LYS A 13 ? ? -67.19 -70.88 40 9 SER A 39 ? ? -48.72 176.40 41 9 GLU A 43 ? ? -59.91 171.01 42 9 PHE A 104 ? ? -49.37 175.15 43 10 PHE A 5 ? ? -63.99 -78.13 44 10 ARG A 24 ? ? -97.31 -62.10 45 10 SER A 39 ? ? -49.01 158.56 46 10 PHE A 104 ? ? -49.27 177.43 47 11 SER A 39 ? ? -49.30 161.64 48 11 GLU A 43 ? ? -54.05 170.88 49 12 SER A 39 ? ? -39.64 157.77 50 12 LYS A 74 ? ? -53.40 177.98 51 12 PHE A 104 ? ? -49.56 179.12 52 13 SER A 7 ? ? -99.62 -63.07 53 13 GLU A 8 ? ? -39.58 -37.12 54 13 GLU A 17 ? ? -39.23 -32.58 55 13 SER A 39 ? ? -48.36 175.62 56 13 LYS A 46 ? ? -160.57 -167.45 57 13 MET A 69 ? ? 72.20 31.33 58 13 PHE A 104 ? ? -51.64 170.50 59 14 LYS A 2 ? ? -87.89 -73.28 60 14 ARG A 24 ? ? -105.19 -64.62 61 14 PHE A 104 ? ? -46.34 172.77 62 15 GLU A 8 ? ? -39.07 -31.11 63 15 SER A 39 ? ? -46.82 171.85 64 15 ARG A 65 ? ? -39.73 -32.18 65 15 PHE A 104 ? ? -46.89 173.19 66 16 LYS A 2 ? ? -79.25 -72.05 67 16 PHE A 5 ? ? -37.75 -32.54 68 16 LYS A 74 ? ? -59.02 177.86 69 16 PHE A 104 ? ? -46.15 172.81 70 17 SER A 7 ? ? -94.73 -60.14 71 17 GLU A 8 ? ? -38.70 -30.18 72 17 PHE A 11 ? ? -54.35 -74.41 73 17 ARG A 24 ? ? -101.57 -61.34 74 17 SER A 39 ? ? -39.47 134.12 75 18 GLU A 8 ? ? -38.92 -30.28 76 18 LYS A 13 ? ? -57.65 -70.80 77 18 ARG A 24 ? ? -105.72 -62.53 78 18 SER A 39 ? ? -49.26 170.11 79 18 ARG A 65 ? ? -39.01 -29.70 80 18 PHE A 104 ? ? -44.15 169.22 81 18 ASN A 113 ? ? -119.60 56.61 82 19 LYS A 2 ? ? -83.40 -71.20 83 19 SER A 7 ? ? -92.55 -64.25 84 19 GLU A 43 ? ? -59.32 170.80 85 19 ASN A 113 ? ? -103.96 54.88 86 20 ASP A 40 ? ? -99.14 32.36 87 20 PHE A 104 ? ? -51.31 -175.86 88 20 ASN A 113 ? ? -101.24 62.63 #