data_2KXA # _entry.id 2KXA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.321 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2KXA RCSB RCSB101688 WWPDB D_1000101688 BMRB 16907 # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 16907 _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KXA _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-04-29 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lorieau, J.L.' 1 'Louis, J.M.' 2 'Bax, A.' 3 # _citation.id primary _citation.title 'The complete influenza hemagglutinin fusion domain adopts a tight helical hairpin arrangement at the lipid:water interface.' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 107 _citation.page_first 11341 _citation.page_last 11346 _citation.year 2010 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20534508 _citation.pdbx_database_id_DOI 10.1073/pnas.1006142107 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lorieau, J.L.' 1 ? primary 'Louis, J.M.' 2 ? primary 'Bax, A.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Haemagglutinin HA2 CHAIN PEPTIDE' _entity.formula_weight 3151.596 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'RESIDUES 1 TO 23 OF HA2 SUBUNIT (UNP Residues 345-367)' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GLFGAIAGFIEGGWTGMIDGWYGSGKKKKD _entity_poly.pdbx_seq_one_letter_code_can GLFGAIAGFIEGGWTGMIDGWYGSGKKKKD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 LEU n 1 3 PHE n 1 4 GLY n 1 5 ALA n 1 6 ILE n 1 7 ALA n 1 8 GLY n 1 9 PHE n 1 10 ILE n 1 11 GLU n 1 12 GLY n 1 13 GLY n 1 14 TRP n 1 15 THR n 1 16 GLY n 1 17 MET n 1 18 ILE n 1 19 ASP n 1 20 GLY n 1 21 TRP n 1 22 TYR n 1 23 GLY n 1 24 SER n 1 25 GLY n 1 26 LYS n 1 27 LYS n 1 28 LYS n 1 29 LYS n 1 30 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'A/swine/Scotland/410440/94(H1N2)' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Influenza A virus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83206 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9YTC2_9INFA _struct_ref.pdbx_db_accession Q9YTC2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GLFGAIAGFIEGGWTGMIDGWYG _struct_ref.pdbx_align_begin 345 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KXA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 23 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9YTC2 _struct_ref_seq.db_align_beg 345 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 367 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 23 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KXA SER A 24 ? UNP Q9YTC2 ? ? 'expression tag' 24 1 1 2KXA GLY A 25 ? UNP Q9YTC2 ? ? 'expression tag' 25 2 1 2KXA LYS A 26 ? UNP Q9YTC2 ? ? 'expression tag' 26 3 1 2KXA LYS A 27 ? UNP Q9YTC2 ? ? 'expression tag' 27 4 1 2KXA LYS A 28 ? UNP Q9YTC2 ? ? 'expression tag' 28 5 1 2KXA LYS A 29 ? UNP Q9YTC2 ? ? 'expression tag' 29 6 1 2KXA ASP A 30 ? UNP Q9YTC2 ? ? 'expression tag' 30 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HSQC' 1 3 2 '2D 1H-1H NOESY' 1 4 1 '3D HNCO' 1 5 1 '3D HNCA' 1 6 1 '3D HN(CO)CA' 1 7 1 '3D 1H-15N NOESY' 2 8 1 '2D 1H-15N HSQC' 2 9 1 '2D 1H-13C HSQC' 2 10 1 '3D HN(CO)CA' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength '20mM Tris' _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 305 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '7 % D2O-1, 25 mM [U-99% 2H] TRIS-2, 130-180 mM [U-99% 2H] DPC-3, 93% H2O/7% D2O' 1 '93% H2O/7% D2O' '25 mM [U-99% 2H] TRIS-4, 130-180 mM [U-99% 2H] DPC-5, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 900 Bruker AVANCE 1 'Bruker Avance' 750 Bruker AVANCE 2 'Bruker Avance' 600 Bruker AVANCE 3 'Bruker Avance' 500 Bruker AVANCE 4 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2KXA _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation 0 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 60 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KXA _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation 1 _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 0 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KXA _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal Goddard 'chemical shift assignment' Sparky 3.113 1 Goddard 'data analysis' Sparky 3.113 2 Goddard 'peak picking' Sparky 3.113 3 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'data analysis' NMRPipe 5.0 4 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'peak picking' NMRPipe 5.0 5 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 5.0 6 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'data analysis' NMRDraw 5.0 7 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'peak picking' NMRDraw 5.0 8 Palmer 'data analysis' ModelFree 4.2 9 'Bhattacharya and Montelione' 'data analysis' PSVS 1.4 10 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS 1.2009.0721.18 11 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' 2.24 12 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' 2.24 13 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KXA _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KXA _struct.title 'The hemagglutinin fusion peptide (H1 subtype) at pH 7.4' _struct.pdbx_descriptor Haemagglutinin _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KXA _struct_keywords.pdbx_keywords 'VIRAL PROTEIN, IMMUNE SYSTEM' _struct_keywords.text 'fusion peptide, influenza, VIRAL PROTEIN, IMMUNE SYSTEM' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id GLY _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 1 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 23 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLY _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 1 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 23 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2KXA _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 TRP 14 14 14 TRP TRP A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 MET 17 17 17 MET MET A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 TRP 21 21 21 TRP TRP A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 GLY 25 25 ? ? ? A . n A 1 26 LYS 26 26 ? ? ? A . n A 1 27 LYS 27 27 ? ? ? A . n A 1 28 LYS 28 28 ? ? ? A . n A 1 29 LYS 29 29 ? ? ? A . n A 1 30 ASP 30 30 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-06-23 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-05 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Experimental preparation' 6 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_sample_details 4 3 'Structure model' pdbx_nmr_software 5 3 'Structure model' pdbx_nmr_spectrometer 6 3 'Structure model' pdbx_struct_assembly 7 3 'Structure model' pdbx_struct_oper_list 8 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_sample_details.contents' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.031 _pdbx_nmr_ensemble_rms.distance_rms_dev_error ? _pdbx_nmr_ensemble_rms.entry_id 2KXA _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id D2O-1 7 ? % ? 1 TRIS-2 25 ? mM '[U-99% 2H]' 1 DPC-3 ? 130-180 mM '[U-99% 2H]' 1 TRIS-4 25 ? mM '[U-99% 2H]' 2 DPC-5 ? 130-180 mM '[U-99% 2H]' 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2KXA _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 449 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 109 _pdbx_nmr_constraints.NOE_long_range_total_count 66 _pdbx_nmr_constraints.NOE_medium_range_total_count 144 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 130 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 4 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 18 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 18 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 25 ? A GLY 25 2 1 Y 1 A LYS 26 ? A LYS 26 3 1 Y 1 A LYS 27 ? A LYS 27 4 1 Y 1 A LYS 28 ? A LYS 28 5 1 Y 1 A LYS 29 ? A LYS 29 6 1 Y 1 A ASP 30 ? A ASP 30 7 2 Y 1 A GLY 25 ? A GLY 25 8 2 Y 1 A LYS 26 ? A LYS 26 9 2 Y 1 A LYS 27 ? A LYS 27 10 2 Y 1 A LYS 28 ? A LYS 28 11 2 Y 1 A LYS 29 ? A LYS 29 12 2 Y 1 A ASP 30 ? A ASP 30 13 3 Y 1 A GLY 25 ? A GLY 25 14 3 Y 1 A LYS 26 ? A LYS 26 15 3 Y 1 A LYS 27 ? A LYS 27 16 3 Y 1 A LYS 28 ? A LYS 28 17 3 Y 1 A LYS 29 ? A LYS 29 18 3 Y 1 A ASP 30 ? A ASP 30 19 4 Y 1 A GLY 25 ? A GLY 25 20 4 Y 1 A LYS 26 ? A LYS 26 21 4 Y 1 A LYS 27 ? A LYS 27 22 4 Y 1 A LYS 28 ? A LYS 28 23 4 Y 1 A LYS 29 ? A LYS 29 24 4 Y 1 A ASP 30 ? A ASP 30 25 5 Y 1 A GLY 25 ? A GLY 25 26 5 Y 1 A LYS 26 ? A LYS 26 27 5 Y 1 A LYS 27 ? A LYS 27 28 5 Y 1 A LYS 28 ? A LYS 28 29 5 Y 1 A LYS 29 ? A LYS 29 30 5 Y 1 A ASP 30 ? A ASP 30 31 6 Y 1 A GLY 25 ? A GLY 25 32 6 Y 1 A LYS 26 ? A LYS 26 33 6 Y 1 A LYS 27 ? A LYS 27 34 6 Y 1 A LYS 28 ? A LYS 28 35 6 Y 1 A LYS 29 ? A LYS 29 36 6 Y 1 A ASP 30 ? A ASP 30 37 7 Y 1 A GLY 25 ? A GLY 25 38 7 Y 1 A LYS 26 ? A LYS 26 39 7 Y 1 A LYS 27 ? A LYS 27 40 7 Y 1 A LYS 28 ? A LYS 28 41 7 Y 1 A LYS 29 ? A LYS 29 42 7 Y 1 A ASP 30 ? A ASP 30 43 8 Y 1 A GLY 25 ? A GLY 25 44 8 Y 1 A LYS 26 ? A LYS 26 45 8 Y 1 A LYS 27 ? A LYS 27 46 8 Y 1 A LYS 28 ? A LYS 28 47 8 Y 1 A LYS 29 ? A LYS 29 48 8 Y 1 A ASP 30 ? A ASP 30 49 9 Y 1 A GLY 25 ? A GLY 25 50 9 Y 1 A LYS 26 ? A LYS 26 51 9 Y 1 A LYS 27 ? A LYS 27 52 9 Y 1 A LYS 28 ? A LYS 28 53 9 Y 1 A LYS 29 ? A LYS 29 54 9 Y 1 A ASP 30 ? A ASP 30 55 10 Y 1 A GLY 25 ? A GLY 25 56 10 Y 1 A LYS 26 ? A LYS 26 57 10 Y 1 A LYS 27 ? A LYS 27 58 10 Y 1 A LYS 28 ? A LYS 28 59 10 Y 1 A LYS 29 ? A LYS 29 60 10 Y 1 A ASP 30 ? A ASP 30 #