data_2KXV # _entry.id 2KXV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KXV pdb_00002kxv 10.2210/pdb2kxv/pdb RCSB RCSB101709 ? ? WWPDB D_1000101709 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-12-22 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_nmr_software 5 3 'Structure model' pdbx_nmr_spectrometer 6 3 'Structure model' pdbx_struct_conn_angle 7 3 'Structure model' struct_conn 8 3 'Structure model' struct_ref_seq_dif 9 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 17 3 'Structure model' '_pdbx_struct_conn_angle.value' 18 3 'Structure model' '_struct_conn.pdbx_dist_value' 19 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 20 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 21 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 22 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 23 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 24 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 25 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 26 3 'Structure model' '_struct_ref_seq_dif.details' 27 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 28 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 29 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KXV _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2010-05-13 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_id 2KXT _pdbx_database_related.db_name PDB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pan, Y.R.' 1 'Lou, Y.C.' 2 'Rizo, J.' 3 'Chen, C.' 4 # _citation.id primary _citation.title 'NMR Structure and Calcium-Binding Properties of the Tellurite Resistance Protein TerD from Klebsiella pneumoniae' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year 2010 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 1089-8638 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21112337 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2010.11.041 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pan, Y.R.' 1 ? primary 'Lou, Y.C.' 2 ? primary 'Seven, A.B.' 3 ? primary 'Rizo, J.' 4 ? primary 'Chen, C.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tellurite resistance protein' 21585.689 1 ? ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSVSLSKGGNVSLSKTAPSMKNVLVGLGWDARSTDGQDFDLDASAFLLAANGKVRGDADFIFYNNLKSADGSVTHTGDNR TGEGDGDDESLKIKLDAVPGDVDKIIFVVTIHDAQARRQSFGQVSGAFIRLVNDDNQTEVARYDLTEDASTETAMLFGEL YRHNGEWKFRAVGQGYAGGLASVCAQYGINASLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSVSLSKGGNVSLSKTAPSMKNVLVGLGWDARSTDGQDFDLDASAFLLAANGKVRGDADFIFYNNLKSADGSVTHTGDNR TGEGDGDDESLKIKLDAVPGDVDKIIFVVTIHDAQARRQSFGQVSGAFIRLVNDDNQTEVARYDLTEDASTETAMLFGEL YRHNGEWKFRAVGQGYAGGLASVCAQYGINASLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 VAL n 1 4 SER n 1 5 LEU n 1 6 SER n 1 7 LYS n 1 8 GLY n 1 9 GLY n 1 10 ASN n 1 11 VAL n 1 12 SER n 1 13 LEU n 1 14 SER n 1 15 LYS n 1 16 THR n 1 17 ALA n 1 18 PRO n 1 19 SER n 1 20 MET n 1 21 LYS n 1 22 ASN n 1 23 VAL n 1 24 LEU n 1 25 VAL n 1 26 GLY n 1 27 LEU n 1 28 GLY n 1 29 TRP n 1 30 ASP n 1 31 ALA n 1 32 ARG n 1 33 SER n 1 34 THR n 1 35 ASP n 1 36 GLY n 1 37 GLN n 1 38 ASP n 1 39 PHE n 1 40 ASP n 1 41 LEU n 1 42 ASP n 1 43 ALA n 1 44 SER n 1 45 ALA n 1 46 PHE n 1 47 LEU n 1 48 LEU n 1 49 ALA n 1 50 ALA n 1 51 ASN n 1 52 GLY n 1 53 LYS n 1 54 VAL n 1 55 ARG n 1 56 GLY n 1 57 ASP n 1 58 ALA n 1 59 ASP n 1 60 PHE n 1 61 ILE n 1 62 PHE n 1 63 TYR n 1 64 ASN n 1 65 ASN n 1 66 LEU n 1 67 LYS n 1 68 SER n 1 69 ALA n 1 70 ASP n 1 71 GLY n 1 72 SER n 1 73 VAL n 1 74 THR n 1 75 HIS n 1 76 THR n 1 77 GLY n 1 78 ASP n 1 79 ASN n 1 80 ARG n 1 81 THR n 1 82 GLY n 1 83 GLU n 1 84 GLY n 1 85 ASP n 1 86 GLY n 1 87 ASP n 1 88 ASP n 1 89 GLU n 1 90 SER n 1 91 LEU n 1 92 LYS n 1 93 ILE n 1 94 LYS n 1 95 LEU n 1 96 ASP n 1 97 ALA n 1 98 VAL n 1 99 PRO n 1 100 GLY n 1 101 ASP n 1 102 VAL n 1 103 ASP n 1 104 LYS n 1 105 ILE n 1 106 ILE n 1 107 PHE n 1 108 VAL n 1 109 VAL n 1 110 THR n 1 111 ILE n 1 112 HIS n 1 113 ASP n 1 114 ALA n 1 115 GLN n 1 116 ALA n 1 117 ARG n 1 118 ARG n 1 119 GLN n 1 120 SER n 1 121 PHE n 1 122 GLY n 1 123 GLN n 1 124 VAL n 1 125 SER n 1 126 GLY n 1 127 ALA n 1 128 PHE n 1 129 ILE n 1 130 ARG n 1 131 LEU n 1 132 VAL n 1 133 ASN n 1 134 ASP n 1 135 ASP n 1 136 ASN n 1 137 GLN n 1 138 THR n 1 139 GLU n 1 140 VAL n 1 141 ALA n 1 142 ARG n 1 143 TYR n 1 144 ASP n 1 145 LEU n 1 146 THR n 1 147 GLU n 1 148 ASP n 1 149 ALA n 1 150 SER n 1 151 THR n 1 152 GLU n 1 153 THR n 1 154 ALA n 1 155 MET n 1 156 LEU n 1 157 PHE n 1 158 GLY n 1 159 GLU n 1 160 LEU n 1 161 TYR n 1 162 ARG n 1 163 HIS n 1 164 ASN n 1 165 GLY n 1 166 GLU n 1 167 TRP n 1 168 LYS n 1 169 PHE n 1 170 ARG n 1 171 ALA n 1 172 VAL n 1 173 GLY n 1 174 GLN n 1 175 GLY n 1 176 TYR n 1 177 ALA n 1 178 GLY n 1 179 GLY n 1 180 LEU n 1 181 ALA n 1 182 SER n 1 183 VAL n 1 184 CYS n 1 185 ALA n 1 186 GLN n 1 187 TYR n 1 188 GLY n 1 189 ILE n 1 190 ASN n 1 191 ALA n 1 192 SER n 1 193 LEU n 1 194 GLU n 1 195 HIS n 1 196 HIS n 1 197 HIS n 1 198 HIS n 1 199 HIS n 1 200 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene terD _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain NTUH-K2044 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Klebsiella pneumoniae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 484021 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL 21 DE3' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET29b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -17 ? ? ? A . n A 1 2 SER 2 -16 ? ? ? A . n A 1 3 VAL 3 -15 ? ? ? A . n A 1 4 SER 4 -14 ? ? ? A . n A 1 5 LEU 5 -13 ? ? ? A . n A 1 6 SER 6 -12 ? ? ? A . n A 1 7 LYS 7 -11 ? ? ? A . n A 1 8 GLY 8 -10 ? ? ? A . n A 1 9 GLY 9 -9 ? ? ? A . n A 1 10 ASN 10 -8 ? ? ? A . n A 1 11 VAL 11 -7 ? ? ? A . n A 1 12 SER 12 -6 ? ? ? A . n A 1 13 LEU 13 -5 ? ? ? A . n A 1 14 SER 14 -4 ? ? ? A . n A 1 15 LYS 15 -3 ? ? ? A . n A 1 16 THR 16 -2 ? ? ? A . n A 1 17 ALA 17 -1 ? ? ? A . n A 1 18 PRO 18 0 ? ? ? A . n A 1 19 SER 19 1 1 SER SER A . n A 1 20 MET 20 2 2 MET MET A . n A 1 21 LYS 21 3 3 LYS LYS A . n A 1 22 ASN 22 4 4 ASN ASN A . n A 1 23 VAL 23 5 5 VAL VAL A . n A 1 24 LEU 24 6 6 LEU LEU A . n A 1 25 VAL 25 7 7 VAL VAL A . n A 1 26 GLY 26 8 8 GLY GLY A . n A 1 27 LEU 27 9 9 LEU LEU A . n A 1 28 GLY 28 10 10 GLY GLY A . n A 1 29 TRP 29 11 11 TRP TRP A . n A 1 30 ASP 30 12 12 ASP ASP A . n A 1 31 ALA 31 13 13 ALA ALA A . n A 1 32 ARG 32 14 14 ARG ARG A . n A 1 33 SER 33 15 15 SER SER A . n A 1 34 THR 34 16 16 THR THR A . n A 1 35 ASP 35 17 17 ASP ASP A . n A 1 36 GLY 36 18 18 GLY GLY A . n A 1 37 GLN 37 19 19 GLN GLN A . n A 1 38 ASP 38 20 20 ASP ASP A . n A 1 39 PHE 39 21 21 PHE PHE A . n A 1 40 ASP 40 22 22 ASP ASP A . n A 1 41 LEU 41 23 23 LEU LEU A . n A 1 42 ASP 42 24 24 ASP ASP A . n A 1 43 ALA 43 25 25 ALA ALA A . n A 1 44 SER 44 26 26 SER SER A . n A 1 45 ALA 45 27 27 ALA ALA A . n A 1 46 PHE 46 28 28 PHE PHE A . n A 1 47 LEU 47 29 29 LEU LEU A . n A 1 48 LEU 48 30 30 LEU LEU A . n A 1 49 ALA 49 31 31 ALA ALA A . n A 1 50 ALA 50 32 32 ALA ALA A . n A 1 51 ASN 51 33 33 ASN ASN A . n A 1 52 GLY 52 34 34 GLY GLY A . n A 1 53 LYS 53 35 35 LYS LYS A . n A 1 54 VAL 54 36 36 VAL VAL A . n A 1 55 ARG 55 37 37 ARG ARG A . n A 1 56 GLY 56 38 38 GLY GLY A . n A 1 57 ASP 57 39 39 ASP ASP A . n A 1 58 ALA 58 40 40 ALA ALA A . n A 1 59 ASP 59 41 41 ASP ASP A . n A 1 60 PHE 60 42 42 PHE PHE A . n A 1 61 ILE 61 43 43 ILE ILE A . n A 1 62 PHE 62 44 44 PHE PHE A . n A 1 63 TYR 63 45 45 TYR TYR A . n A 1 64 ASN 64 46 46 ASN ASN A . n A 1 65 ASN 65 47 47 ASN ASN A . n A 1 66 LEU 66 48 48 LEU LEU A . n A 1 67 LYS 67 49 49 LYS LYS A . n A 1 68 SER 68 50 50 SER SER A . n A 1 69 ALA 69 51 51 ALA ALA A . n A 1 70 ASP 70 52 52 ASP ASP A . n A 1 71 GLY 71 53 53 GLY GLY A . n A 1 72 SER 72 54 54 SER SER A . n A 1 73 VAL 73 55 55 VAL VAL A . n A 1 74 THR 74 56 56 THR THR A . n A 1 75 HIS 75 57 57 HIS HIS A . n A 1 76 THR 76 58 58 THR THR A . n A 1 77 GLY 77 59 59 GLY GLY A . n A 1 78 ASP 78 60 60 ASP ASP A . n A 1 79 ASN 79 61 61 ASN ASN A . n A 1 80 ARG 80 62 62 ARG ARG A . n A 1 81 THR 81 63 63 THR THR A . n A 1 82 GLY 82 64 64 GLY GLY A . n A 1 83 GLU 83 65 65 GLU GLU A . n A 1 84 GLY 84 66 66 GLY GLY A . n A 1 85 ASP 85 67 67 ASP ASP A . n A 1 86 GLY 86 68 68 GLY GLY A . n A 1 87 ASP 87 69 69 ASP ASP A . n A 1 88 ASP 88 70 70 ASP ASP A . n A 1 89 GLU 89 71 71 GLU GLU A . n A 1 90 SER 90 72 72 SER SER A . n A 1 91 LEU 91 73 73 LEU LEU A . n A 1 92 LYS 92 74 74 LYS LYS A . n A 1 93 ILE 93 75 75 ILE ILE A . n A 1 94 LYS 94 76 76 LYS LYS A . n A 1 95 LEU 95 77 77 LEU LEU A . n A 1 96 ASP 96 78 78 ASP ASP A . n A 1 97 ALA 97 79 79 ALA ALA A . n A 1 98 VAL 98 80 80 VAL VAL A . n A 1 99 PRO 99 81 81 PRO PRO A . n A 1 100 GLY 100 82 82 GLY GLY A . n A 1 101 ASP 101 83 83 ASP ASP A . n A 1 102 VAL 102 84 84 VAL VAL A . n A 1 103 ASP 103 85 85 ASP ASP A . n A 1 104 LYS 104 86 86 LYS LYS A . n A 1 105 ILE 105 87 87 ILE ILE A . n A 1 106 ILE 106 88 88 ILE ILE A . n A 1 107 PHE 107 89 89 PHE PHE A . n A 1 108 VAL 108 90 90 VAL VAL A . n A 1 109 VAL 109 91 91 VAL VAL A . n A 1 110 THR 110 92 92 THR THR A . n A 1 111 ILE 111 93 93 ILE ILE A . n A 1 112 HIS 112 94 94 HIS HIS A . n A 1 113 ASP 113 95 95 ASP ASP A . n A 1 114 ALA 114 96 96 ALA ALA A . n A 1 115 GLN 115 97 97 GLN GLN A . n A 1 116 ALA 116 98 98 ALA ALA A . n A 1 117 ARG 117 99 99 ARG ARG A . n A 1 118 ARG 118 100 100 ARG ARG A . n A 1 119 GLN 119 101 101 GLN GLN A . n A 1 120 SER 120 102 102 SER SER A . n A 1 121 PHE 121 103 103 PHE PHE A . n A 1 122 GLY 122 104 104 GLY GLY A . n A 1 123 GLN 123 105 105 GLN GLN A . n A 1 124 VAL 124 106 106 VAL VAL A . n A 1 125 SER 125 107 107 SER SER A . n A 1 126 GLY 126 108 108 GLY GLY A . n A 1 127 ALA 127 109 109 ALA ALA A . n A 1 128 PHE 128 110 110 PHE PHE A . n A 1 129 ILE 129 111 111 ILE ILE A . n A 1 130 ARG 130 112 112 ARG ARG A . n A 1 131 LEU 131 113 113 LEU LEU A . n A 1 132 VAL 132 114 114 VAL VAL A . n A 1 133 ASN 133 115 115 ASN ASN A . n A 1 134 ASP 134 116 116 ASP ASP A . n A 1 135 ASP 135 117 117 ASP ASP A . n A 1 136 ASN 136 118 118 ASN ASN A . n A 1 137 GLN 137 119 119 GLN GLN A . n A 1 138 THR 138 120 120 THR THR A . n A 1 139 GLU 139 121 121 GLU GLU A . n A 1 140 VAL 140 122 122 VAL VAL A . n A 1 141 ALA 141 123 123 ALA ALA A . n A 1 142 ARG 142 124 124 ARG ARG A . n A 1 143 TYR 143 125 125 TYR TYR A . n A 1 144 ASP 144 126 126 ASP ASP A . n A 1 145 LEU 145 127 127 LEU LEU A . n A 1 146 THR 146 128 128 THR THR A . n A 1 147 GLU 147 129 129 GLU GLU A . n A 1 148 ASP 148 130 130 ASP ASP A . n A 1 149 ALA 149 131 131 ALA ALA A . n A 1 150 SER 150 132 132 SER SER A . n A 1 151 THR 151 133 133 THR THR A . n A 1 152 GLU 152 134 134 GLU GLU A . n A 1 153 THR 153 135 135 THR THR A . n A 1 154 ALA 154 136 136 ALA ALA A . n A 1 155 MET 155 137 137 MET MET A . n A 1 156 LEU 156 138 138 LEU LEU A . n A 1 157 PHE 157 139 139 PHE PHE A . n A 1 158 GLY 158 140 140 GLY GLY A . n A 1 159 GLU 159 141 141 GLU GLU A . n A 1 160 LEU 160 142 142 LEU LEU A . n A 1 161 TYR 161 143 143 TYR TYR A . n A 1 162 ARG 162 144 144 ARG ARG A . n A 1 163 HIS 163 145 145 HIS HIS A . n A 1 164 ASN 164 146 146 ASN ASN A . n A 1 165 GLY 165 147 147 GLY GLY A . n A 1 166 GLU 166 148 148 GLU GLU A . n A 1 167 TRP 167 149 149 TRP TRP A . n A 1 168 LYS 168 150 150 LYS LYS A . n A 1 169 PHE 169 151 151 PHE PHE A . n A 1 170 ARG 170 152 152 ARG ARG A . n A 1 171 ALA 171 153 153 ALA ALA A . n A 1 172 VAL 172 154 154 VAL VAL A . n A 1 173 GLY 173 155 155 GLY GLY A . n A 1 174 GLN 174 156 156 GLN GLN A . n A 1 175 GLY 175 157 157 GLY GLY A . n A 1 176 TYR 176 158 158 TYR TYR A . n A 1 177 ALA 177 159 159 ALA ALA A . n A 1 178 GLY 178 160 160 GLY GLY A . n A 1 179 GLY 179 161 161 GLY GLY A . n A 1 180 LEU 180 162 162 LEU LEU A . n A 1 181 ALA 181 163 163 ALA ALA A . n A 1 182 SER 182 164 164 SER SER A . n A 1 183 VAL 183 165 165 VAL VAL A . n A 1 184 CYS 184 166 166 CYS CYS A . n A 1 185 ALA 185 167 167 ALA ALA A . n A 1 186 GLN 186 168 168 GLN GLN A . n A 1 187 TYR 187 169 169 TYR TYR A . n A 1 188 GLY 188 170 170 GLY GLY A . n A 1 189 ILE 189 171 171 ILE ILE A . n A 1 190 ASN 190 172 172 ASN ASN A . n A 1 191 ALA 191 173 173 ALA ALA A . n A 1 192 SER 192 174 174 SER SER A . n A 1 193 LEU 193 175 ? ? ? A . n A 1 194 GLU 194 176 ? ? ? A . n A 1 195 HIS 195 177 ? ? ? A . n A 1 196 HIS 196 178 ? ? ? A . n A 1 197 HIS 197 179 ? ? ? A . n A 1 198 HIS 198 180 ? ? ? A . n A 1 199 HIS 199 181 ? ? ? A . n A 1 200 HIS 200 182 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 201 201 CA CA A . C 2 CA 1 202 202 CA CA A . # _cell.entry_id 2KXV _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2KXV _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KXV _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KXV _struct.title 'NMR structure and calcium-binding properties of the tellurite resistance protein TerD from Klebsiella pneumoniae' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KXV _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' _struct_keywords.text 'KP-TerD, tellurite resistance, Ca2+ binding protein, calcium signaling, UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code C4XDJ3_KLEPN _struct_ref.pdbx_db_accession C4XDJ3 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSVSLSKGGNVSLSKTAPSMKNVLVGLGWDARSTDGQDFDLDASAFLLAANGKVRGDADFIFYNNLKSADGSVTHTGDNR TGEGDGDDESLKIKLDAVPGDVDKIIFVVTIHDAQARRQSFGQVSGAFIRLVNDDNQTEVARYDLTEDASTETAMLFGEL YRHNGEWKFRAVGQGYAGGLASVCAQYGINAS ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KXV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 192 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession C4XDJ3 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 192 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -17 _struct_ref_seq.pdbx_auth_seq_align_end 174 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KXV LEU A 193 ? UNP C4XDJ3 ? ? 'expression tag' 175 1 1 2KXV GLU A 194 ? UNP C4XDJ3 ? ? 'expression tag' 176 2 1 2KXV HIS A 195 ? UNP C4XDJ3 ? ? 'expression tag' 177 3 1 2KXV HIS A 196 ? UNP C4XDJ3 ? ? 'expression tag' 178 4 1 2KXV HIS A 197 ? UNP C4XDJ3 ? ? 'expression tag' 179 5 1 2KXV HIS A 198 ? UNP C4XDJ3 ? ? 'expression tag' 180 6 1 2KXV HIS A 199 ? UNP C4XDJ3 ? ? 'expression tag' 181 7 1 2KXV HIS A 200 ? UNP C4XDJ3 ? ? 'expression tag' 182 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 56 ? PHE A 60 ? GLY A 38 PHE A 42 5 ? 5 HELX_P HELX_P2 2 LEU A 95 ? VAL A 98 ? LEU A 77 VAL A 80 5 ? 4 HELX_P HELX_P3 3 ASP A 113 ? ALA A 116 ? ASP A 95 ALA A 98 5 ? 4 HELX_P HELX_P4 4 SER A 120 ? VAL A 124 ? SER A 102 VAL A 106 5 ? 5 HELX_P HELX_P5 5 ASP A 144 ? ALA A 149 ? ASP A 126 ALA A 131 1 ? 6 HELX_P HELX_P6 6 ALA A 181 ? GLN A 186 ? ALA A 163 GLN A 168 1 ? 6 HELX_P HELX_P7 7 TYR A 187 ? ILE A 189 ? TYR A 169 ILE A 171 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A TRP 29 O ? ? ? 1_555 C CA . CA ? ? A TRP 11 A CA 202 1_555 ? ? ? ? ? ? ? 2.603 ? ? metalc2 metalc ? ? A ASP 40 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 22 A CA 201 1_555 ? ? ? ? ? ? ? 2.199 ? ? metalc3 metalc ? ? A ASP 40 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 22 A CA 201 1_555 ? ? ? ? ? ? ? 2.731 ? ? metalc4 metalc ? ? A LEU 41 O ? ? ? 1_555 B CA . CA ? ? A LEU 23 A CA 201 1_555 ? ? ? ? ? ? ? 2.608 ? ? metalc5 metalc ? ? A ASP 42 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 24 A CA 201 1_555 ? ? ? ? ? ? ? 2.610 ? ? metalc6 metalc ? ? A ASP 78 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 60 A CA 201 1_555 ? ? ? ? ? ? ? 2.256 ? ? metalc7 metalc ? ? A ASP 78 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 60 A CA 201 1_555 ? ? ? ? ? ? ? 2.522 ? ? metalc8 metalc ? ? A ASN 79 O ? ? ? 1_555 B CA . CA ? ? A ASN 61 A CA 201 1_555 ? ? ? ? ? ? ? 2.615 ? ? metalc9 metalc ? ? A GLY 82 O ? ? ? 1_555 C CA . CA ? ? A GLY 64 A CA 202 1_555 ? ? ? ? ? ? ? 2.418 ? ? metalc10 metalc ? ? A GLY 84 O ? ? ? 1_555 C CA . CA ? ? A GLY 66 A CA 202 1_555 ? ? ? ? ? ? ? 2.604 ? ? metalc11 metalc ? ? A ASP 88 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 70 A CA 202 1_555 ? ? ? ? ? ? ? 2.589 ? ? metalc12 metalc ? ? A ASP 88 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 70 A CA 202 1_555 ? ? ? ? ? ? ? 2.603 ? ? metalc13 metalc ? ? A GLU 89 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 71 A CA 201 1_555 ? ? ? ? ? ? ? 2.597 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A TRP 29 ? A TRP 11 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? A GLY 82 ? A GLY 64 ? 1_555 89.2 ? 2 O ? A TRP 29 ? A TRP 11 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? A GLY 84 ? A GLY 66 ? 1_555 149.9 ? 3 O ? A GLY 82 ? A GLY 64 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 O ? A GLY 84 ? A GLY 66 ? 1_555 98.6 ? 4 O ? A TRP 29 ? A TRP 11 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASP 88 ? A ASP 70 ? 1_555 127.9 ? 5 O ? A GLY 82 ? A GLY 64 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASP 88 ? A ASP 70 ? 1_555 70.6 ? 6 O ? A GLY 84 ? A GLY 66 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD1 ? A ASP 88 ? A ASP 70 ? 1_555 81.9 ? 7 O ? A TRP 29 ? A TRP 11 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD2 ? A ASP 88 ? A ASP 70 ? 1_555 80.5 ? 8 O ? A GLY 82 ? A GLY 64 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD2 ? A ASP 88 ? A ASP 70 ? 1_555 78.2 ? 9 O ? A GLY 84 ? A GLY 66 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD2 ? A ASP 88 ? A ASP 70 ? 1_555 129.5 ? 10 OD1 ? A ASP 88 ? A ASP 70 ? 1_555 CA ? C CA . ? A CA 202 ? 1_555 OD2 ? A ASP 88 ? A ASP 70 ? 1_555 49.0 ? 11 OD1 ? A ASP 40 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD2 ? A ASP 40 ? A ASP 22 ? 1_555 50.4 ? 12 OD1 ? A ASP 40 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A LEU 41 ? A LEU 23 ? 1_555 87.1 ? 13 OD2 ? A ASP 40 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A LEU 41 ? A LEU 23 ? 1_555 102.3 ? 14 OD1 ? A ASP 40 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASP 42 ? A ASP 24 ? 1_555 117.9 ? 15 OD2 ? A ASP 40 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASP 42 ? A ASP 24 ? 1_555 82.8 ? 16 O ? A LEU 41 ? A LEU 23 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASP 42 ? A ASP 24 ? 1_555 62.9 ? 17 OD1 ? A ASP 40 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASP 78 ? A ASP 60 ? 1_555 131.1 ? 18 OD2 ? A ASP 40 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASP 78 ? A ASP 60 ? 1_555 102.7 ? 19 O ? A LEU 41 ? A LEU 23 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASP 78 ? A ASP 60 ? 1_555 141.8 ? 20 OD1 ? A ASP 42 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD1 ? A ASP 78 ? A ASP 60 ? 1_555 92.2 ? 21 OD1 ? A ASP 40 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD2 ? A ASP 78 ? A ASP 60 ? 1_555 174.4 ? 22 OD2 ? A ASP 40 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD2 ? A ASP 78 ? A ASP 60 ? 1_555 134.4 ? 23 O ? A LEU 41 ? A LEU 23 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD2 ? A ASP 78 ? A ASP 60 ? 1_555 88.8 ? 24 OD1 ? A ASP 42 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD2 ? A ASP 78 ? A ASP 60 ? 1_555 63.1 ? 25 OD1 ? A ASP 78 ? A ASP 60 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OD2 ? A ASP 78 ? A ASP 60 ? 1_555 53.2 ? 26 OD1 ? A ASP 40 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A ASN 79 ? A ASN 61 ? 1_555 74.6 ? 27 OD2 ? A ASP 40 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A ASN 79 ? A ASN 61 ? 1_555 85.2 ? 28 O ? A LEU 41 ? A LEU 23 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A ASN 79 ? A ASN 61 ? 1_555 149.0 ? 29 OD1 ? A ASP 42 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A ASN 79 ? A ASN 61 ? 1_555 148.0 ? 30 OD1 ? A ASP 78 ? A ASP 60 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A ASN 79 ? A ASN 61 ? 1_555 61.7 ? 31 OD2 ? A ASP 78 ? A ASP 60 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 O ? A ASN 79 ? A ASN 61 ? 1_555 107.5 ? 32 OD1 ? A ASP 40 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 89 ? A GLU 71 ? 1_555 117.5 ? 33 OD2 ? A ASP 40 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 89 ? A GLU 71 ? 1_555 163.2 ? 34 O ? A LEU 41 ? A LEU 23 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 89 ? A GLU 71 ? 1_555 62.9 ? 35 OD1 ? A ASP 42 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 89 ? A GLU 71 ? 1_555 96.2 ? 36 OD1 ? A ASP 78 ? A ASP 60 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 89 ? A GLU 71 ? 1_555 94.1 ? 37 OD2 ? A ASP 78 ? A ASP 60 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 89 ? A GLU 71 ? 1_555 57.1 ? 38 O ? A ASN 79 ? A ASN 61 ? 1_555 CA ? B CA . ? A CA 201 ? 1_555 OE2 ? A GLU 89 ? A GLU 71 ? 1_555 103.5 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 73 ? HIS A 75 ? VAL A 55 HIS A 57 A 2 GLU A 89 ? ILE A 93 ? GLU A 71 ILE A 75 A 3 VAL A 23 ? GLY A 28 ? VAL A 5 GLY A 10 A 4 PHE A 128 ? VAL A 132 ? PHE A 110 VAL A 114 A 5 GLU A 139 ? ALA A 141 ? GLU A 121 ALA A 123 B 1 LEU A 41 ? LEU A 48 ? LEU A 23 LEU A 30 B 2 LYS A 104 ? ILE A 111 ? LYS A 86 ILE A 93 B 3 MET A 155 ? HIS A 163 ? MET A 137 HIS A 145 B 4 GLU A 166 ? GLN A 174 ? GLU A 148 GLN A 156 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N THR A 74 ? N THR A 56 O LYS A 92 ? O LYS A 74 A 2 3 O GLU A 89 ? O GLU A 71 N LEU A 27 ? N LEU A 9 A 3 4 N GLY A 26 ? N GLY A 8 O ARG A 130 ? O ARG A 112 A 4 5 N LEU A 131 ? N LEU A 113 O VAL A 140 ? O VAL A 122 B 1 2 N SER A 44 ? N SER A 26 O VAL A 108 ? O VAL A 90 B 2 3 N ILE A 105 ? N ILE A 87 O LEU A 160 ? O LEU A 142 B 3 4 N GLU A 159 ? N GLU A 141 O ARG A 170 ? O ARG A 152 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 201 ? 6 'BINDING SITE FOR RESIDUE CA A 201' AC2 Software A CA 202 ? 4 'BINDING SITE FOR RESIDUE CA A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ASP A 40 ? ASP A 22 . ? 1_555 ? 2 AC1 6 LEU A 41 ? LEU A 23 . ? 1_555 ? 3 AC1 6 ASP A 42 ? ASP A 24 . ? 1_555 ? 4 AC1 6 ASP A 78 ? ASP A 60 . ? 1_555 ? 5 AC1 6 ASN A 79 ? ASN A 61 . ? 1_555 ? 6 AC1 6 GLU A 89 ? GLU A 71 . ? 1_555 ? 7 AC2 4 TRP A 29 ? TRP A 11 . ? 1_555 ? 8 AC2 4 GLY A 82 ? GLY A 64 . ? 1_555 ? 9 AC2 4 GLY A 84 ? GLY A 66 . ? 1_555 ? 10 AC2 4 ASP A 88 ? ASP A 70 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 4 HG A CYS 166 ? ? H A ALA 167 ? ? 1.33 2 6 HG A SER 50 ? ? H A GLY 53 ? ? 1.32 3 7 HG1 A THR 16 ? ? H A ASP 17 ? ? 1.34 4 8 HD21 A ASN 115 ? ? H A GLN 119 ? ? 1.27 5 12 HD22 A ASN 115 ? ? HG1 A THR 120 ? ? 1.33 6 16 HD21 A ASN 61 ? ? H A ARG 62 ? ? 1.24 7 16 HG A SER 50 ? ? H A GLY 53 ? ? 1.30 8 20 HD21 A ASN 61 ? ? H A ARG 62 ? ? 1.24 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 17 ? ? -155.71 16.18 2 1 ARG A 37 ? ? -66.20 4.86 3 1 ALA A 40 ? ? -56.30 -2.70 4 1 SER A 54 ? ? 57.33 15.33 5 1 ASN A 61 ? ? -68.05 -171.57 6 1 THR A 63 ? ? -157.09 -34.99 7 1 ASP A 67 ? ? -77.57 43.94 8 1 ASP A 69 ? ? -62.25 99.36 9 1 ASP A 70 ? ? -50.41 -81.47 10 1 PRO A 81 ? ? -44.34 174.90 11 1 HIS A 94 ? ? -61.88 -138.76 12 1 ARG A 100 ? ? 58.98 79.71 13 1 GLN A 101 ? ? -150.95 64.42 14 1 ASP A 116 ? ? -55.88 -7.30 15 1 THR A 128 ? ? -45.14 -19.48 16 1 SER A 132 ? ? -61.83 2.93 17 1 GLU A 134 ? ? -166.34 -150.24 18 1 VAL A 154 ? ? -137.15 -33.12 19 1 ALA A 159 ? ? -71.18 39.23 20 2 LYS A 3 ? ? -48.55 -19.43 21 2 THR A 16 ? ? -158.18 -35.21 22 2 ASP A 17 ? ? -158.10 40.73 23 2 ARG A 37 ? ? -63.21 1.90 24 2 ALA A 40 ? ? -55.68 -5.14 25 2 PHE A 44 ? ? -171.27 -162.63 26 2 TYR A 45 ? ? 54.05 -113.17 27 2 SER A 54 ? ? 56.56 13.38 28 2 ASN A 61 ? ? -64.94 -166.50 29 2 THR A 63 ? ? -153.52 -34.61 30 2 ASP A 70 ? ? -65.57 -78.15 31 2 LEU A 77 ? ? -53.12 -7.77 32 2 PRO A 81 ? ? -44.73 176.22 33 2 ASP A 95 ? ? -49.63 -18.14 34 2 ARG A 100 ? ? 59.20 89.43 35 2 ASP A 130 ? ? -87.06 -73.22 36 2 ALA A 131 ? ? -79.48 20.09 37 2 SER A 132 ? ? -43.64 -17.52 38 2 THR A 135 ? ? -140.55 12.12 39 2 HIS A 145 ? ? -109.97 -117.17 40 2 VAL A 154 ? ? -133.67 -31.77 41 2 ALA A 159 ? ? -84.49 35.67 42 3 MET A 2 ? ? -174.08 42.82 43 3 LYS A 3 ? ? -153.07 -38.29 44 3 THR A 16 ? ? -91.63 -90.35 45 3 GLN A 19 ? ? -56.56 176.71 46 3 ASP A 20 ? ? -175.92 -166.18 47 3 ALA A 40 ? ? -61.54 3.33 48 3 ASN A 46 ? ? -49.07 -10.78 49 3 THR A 63 ? ? -153.52 -34.16 50 3 ASP A 70 ? ? -56.31 -72.68 51 3 ASP A 78 ? ? -66.59 5.01 52 3 PRO A 81 ? ? -76.08 -164.78 53 3 HIS A 94 ? ? -81.96 -134.56 54 3 ARG A 100 ? ? 53.50 78.21 55 3 ASP A 116 ? ? -56.45 -7.34 56 3 SER A 132 ? ? -59.21 2.76 57 3 GLU A 134 ? ? -173.56 -144.81 58 3 VAL A 154 ? ? -145.76 -35.05 59 4 ASP A 17 ? ? -158.65 18.01 60 4 ARG A 37 ? ? -60.00 -4.69 61 4 ALA A 40 ? ? -65.57 7.64 62 4 TYR A 45 ? ? -44.07 -16.96 63 4 ASN A 61 ? ? -79.74 -164.77 64 4 ARG A 62 ? ? -147.07 13.76 65 4 THR A 63 ? ? -151.93 -35.20 66 4 ASP A 83 ? ? -142.82 -59.63 67 4 ASP A 95 ? ? -48.25 -18.41 68 4 ARG A 100 ? ? 57.63 96.28 69 4 ASP A 116 ? ? -52.74 -8.86 70 4 SER A 132 ? ? -58.63 -0.82 71 4 GLU A 134 ? ? -172.32 -153.76 72 4 HIS A 145 ? ? -117.10 -119.81 73 4 VAL A 154 ? ? -132.63 -40.85 74 4 ALA A 159 ? ? -55.61 -5.05 75 4 LEU A 162 ? ? -47.32 -13.27 76 4 ALA A 173 ? ? -80.55 36.20 77 5 MET A 2 ? ? -160.51 43.85 78 5 THR A 16 ? ? -153.89 -38.60 79 5 ASP A 17 ? ? -158.03 44.58 80 5 ARG A 37 ? ? -69.14 7.55 81 5 ALA A 40 ? ? -56.77 -0.82 82 5 PHE A 44 ? ? -155.82 -156.00 83 5 ASN A 46 ? ? -66.13 5.23 84 5 SER A 54 ? ? 58.99 16.60 85 5 ASN A 61 ? ? -59.89 -171.37 86 5 THR A 63 ? ? -155.98 -35.95 87 5 ASP A 70 ? ? -58.51 -80.32 88 5 ALA A 79 ? ? -143.92 26.04 89 5 ASP A 83 ? ? -92.29 -60.90 90 5 ASP A 85 ? ? -134.65 -33.34 91 5 ASP A 95 ? ? -48.68 -18.31 92 5 ARG A 100 ? ? 55.19 95.21 93 5 GLU A 121 ? ? -45.14 155.66 94 5 VAL A 122 ? ? -139.90 -33.14 95 5 SER A 132 ? ? -57.63 3.06 96 5 GLU A 134 ? ? -175.27 -144.68 97 5 VAL A 154 ? ? -146.44 -35.87 98 6 MET A 2 ? ? -49.50 101.66 99 6 THR A 16 ? ? -152.82 -81.61 100 6 ARG A 37 ? ? -63.30 1.47 101 6 ALA A 40 ? ? -55.77 -4.37 102 6 PHE A 44 ? ? -166.40 -150.50 103 6 TYR A 45 ? ? -59.61 0.30 104 6 SER A 54 ? ? 56.78 15.44 105 6 THR A 63 ? ? -150.28 -32.95 106 6 ASP A 69 ? ? -50.00 100.82 107 6 ASP A 78 ? ? -59.90 -3.20 108 6 HIS A 94 ? ? -98.69 -66.29 109 6 ASP A 95 ? ? -46.67 -17.87 110 6 ARG A 100 ? ? 54.80 98.55 111 6 VAL A 122 ? ? -96.63 -62.19 112 6 SER A 132 ? ? -60.69 3.00 113 6 GLU A 134 ? ? -169.48 -150.16 114 6 VAL A 154 ? ? -148.73 -36.22 115 7 ASP A 17 ? ? -158.35 18.19 116 7 ASP A 20 ? ? -174.70 149.31 117 7 ALA A 40 ? ? -64.09 6.42 118 7 PHE A 44 ? ? -169.84 100.44 119 7 TYR A 45 ? ? 59.60 -71.52 120 7 ASN A 46 ? ? -47.35 -12.14 121 7 SER A 54 ? ? 57.48 18.61 122 7 THR A 63 ? ? -153.49 -34.85 123 7 ASP A 67 ? ? -69.00 66.77 124 7 PRO A 81 ? ? -77.28 -166.74 125 7 HIS A 94 ? ? -64.71 -126.98 126 7 ARG A 100 ? ? 54.57 79.20 127 7 GLN A 101 ? ? -154.14 77.22 128 7 PHE A 103 ? ? -46.58 -18.74 129 7 GLN A 105 ? ? -47.65 -18.63 130 7 ASP A 116 ? ? -57.48 -6.39 131 7 SER A 132 ? ? -55.93 2.62 132 7 GLU A 134 ? ? -171.03 -142.94 133 7 THR A 135 ? ? -138.53 -35.38 134 7 HIS A 145 ? ? -129.18 -104.64 135 7 VAL A 154 ? ? -147.60 -35.53 136 7 ALA A 159 ? ? -77.71 23.93 137 7 LEU A 162 ? ? -47.36 -13.35 138 8 ARG A 37 ? ? -65.25 3.83 139 8 ALA A 40 ? ? -56.09 -1.70 140 8 PHE A 44 ? ? -157.58 -157.43 141 8 ASN A 46 ? ? -59.37 -3.25 142 8 SER A 54 ? ? 58.08 14.46 143 8 THR A 63 ? ? -140.47 -29.69 144 8 LEU A 77 ? ? -55.03 -4.88 145 8 PRO A 81 ? ? -76.34 -168.62 146 8 HIS A 94 ? ? -99.55 -70.23 147 8 ASP A 95 ? ? -47.57 -17.90 148 8 ARG A 100 ? ? 55.49 99.33 149 8 GLN A 119 ? ? 67.99 61.31 150 8 GLU A 134 ? ? -171.90 -173.72 151 8 HIS A 145 ? ? -118.70 -118.13 152 8 VAL A 154 ? ? -147.92 -36.09 153 8 ALA A 159 ? ? -93.19 41.44 154 8 LEU A 162 ? ? -47.76 -12.65 155 8 ALA A 173 ? ? -80.38 40.05 156 9 THR A 16 ? ? -154.19 -47.77 157 9 ASP A 17 ? ? -146.10 34.68 158 9 ALA A 40 ? ? -68.71 10.54 159 9 PHE A 44 ? ? -127.95 -166.83 160 9 THR A 63 ? ? -154.17 -37.37 161 9 PRO A 81 ? ? -78.47 -163.51 162 9 HIS A 94 ? ? -108.79 -61.47 163 9 ASP A 95 ? ? -47.41 -19.00 164 9 ARG A 100 ? ? 53.63 85.12 165 9 ASP A 116 ? ? -56.47 -9.31 166 9 SER A 132 ? ? -64.77 3.02 167 9 GLU A 134 ? ? 170.81 -167.11 168 9 VAL A 154 ? ? -143.10 -34.00 169 10 THR A 16 ? ? -161.36 -34.47 170 10 ASP A 17 ? ? -157.19 42.33 171 10 ASP A 20 ? ? -173.15 -162.65 172 10 ARG A 37 ? ? -63.67 2.96 173 10 ALA A 40 ? ? -56.60 -6.19 174 10 PHE A 44 ? ? -123.89 -168.81 175 10 TYR A 45 ? ? -82.87 31.10 176 10 ASN A 46 ? ? -170.46 22.82 177 10 ASN A 47 ? ? -87.88 36.43 178 10 LEU A 48 ? ? 45.55 26.30 179 10 LYS A 49 ? ? 58.50 129.13 180 10 THR A 63 ? ? -152.52 -32.53 181 10 ASP A 67 ? ? -67.07 -165.35 182 10 ASP A 70 ? ? -77.04 -72.29 183 10 PRO A 81 ? ? -77.10 -161.17 184 10 ASP A 83 ? ? -90.40 -72.08 185 10 HIS A 94 ? ? -96.34 -65.48 186 10 ASP A 95 ? ? -47.45 -18.04 187 10 ARG A 100 ? ? 56.96 104.94 188 10 SER A 132 ? ? -55.52 -1.27 189 10 GLU A 134 ? ? -173.72 -148.93 190 10 VAL A 154 ? ? -148.08 -40.12 191 11 MET A 2 ? ? -79.66 42.35 192 11 ASP A 17 ? ? 49.99 16.67 193 11 ARG A 37 ? ? -65.13 2.95 194 11 ALA A 40 ? ? -56.29 -3.88 195 11 PHE A 44 ? ? -164.21 -156.19 196 11 ASN A 46 ? ? -48.47 -12.28 197 11 THR A 63 ? ? -155.21 -33.73 198 11 ASP A 67 ? ? 58.19 108.46 199 11 ASP A 70 ? ? -48.32 -76.55 200 11 PRO A 81 ? ? -77.88 -161.50 201 11 HIS A 94 ? ? -93.13 -63.57 202 11 ASP A 95 ? ? -48.63 -18.15 203 11 ARG A 100 ? ? 57.27 102.27 204 11 ASP A 116 ? ? -55.66 -8.85 205 11 SER A 132 ? ? -55.19 -0.30 206 11 GLU A 134 ? ? -174.75 -149.27 207 11 VAL A 154 ? ? -137.09 -35.42 208 11 LEU A 162 ? ? -47.19 -13.40 209 11 ALA A 173 ? ? -80.50 -159.50 210 12 MET A 2 ? ? -175.21 -179.14 211 12 ASP A 17 ? ? -155.96 15.74 212 12 ARG A 37 ? ? -68.78 6.61 213 12 ALA A 40 ? ? -57.47 -2.08 214 12 TYR A 45 ? ? -44.97 -15.38 215 12 THR A 63 ? ? -147.57 -34.74 216 12 ASP A 67 ? ? -52.31 89.40 217 12 ASP A 70 ? ? -152.86 -35.40 218 12 PRO A 81 ? ? -49.19 -170.47 219 12 HIS A 94 ? ? -94.56 -63.72 220 12 ASP A 95 ? ? -48.68 -18.30 221 12 ARG A 100 ? ? 58.96 97.41 222 12 ASP A 116 ? ? -56.57 -6.09 223 12 SER A 132 ? ? -58.73 1.43 224 12 GLU A 134 ? ? -172.95 -144.67 225 12 THR A 135 ? ? -130.19 -34.27 226 12 VAL A 154 ? ? -134.55 -32.27 227 12 ALA A 159 ? ? -90.91 48.22 228 13 THR A 16 ? ? -157.03 -79.20 229 13 ASP A 20 ? ? -175.85 -163.86 230 13 ARG A 37 ? ? -68.44 7.23 231 13 ALA A 40 ? ? -57.35 -1.17 232 13 PHE A 44 ? ? -122.51 -165.40 233 13 SER A 54 ? ? 56.05 18.20 234 13 THR A 63 ? ? -152.77 -35.09 235 13 ASP A 67 ? ? -80.45 46.80 236 13 PRO A 81 ? ? -78.03 -161.61 237 13 HIS A 94 ? ? -69.07 -141.93 238 13 ALA A 96 ? ? -49.42 -19.27 239 13 ARG A 100 ? ? 56.37 81.85 240 13 GLN A 101 ? ? -150.47 75.37 241 13 ASP A 116 ? ? -55.36 -7.87 242 13 SER A 132 ? ? -53.39 -3.83 243 13 GLU A 134 ? ? -173.63 -146.81 244 13 HIS A 145 ? ? -127.15 -104.19 245 13 VAL A 154 ? ? -142.25 -34.12 246 14 THR A 16 ? ? -153.28 -78.05 247 14 ALA A 40 ? ? -61.42 3.90 248 14 PHE A 44 ? ? -103.69 -168.72 249 14 SER A 54 ? ? 59.49 13.27 250 14 ARG A 62 ? ? -148.00 12.92 251 14 THR A 63 ? ? -153.85 -34.23 252 14 ASP A 78 ? ? -63.74 4.30 253 14 PRO A 81 ? ? -77.15 -161.61 254 14 HIS A 94 ? ? -62.00 -130.81 255 14 ARG A 100 ? ? 61.92 88.55 256 14 GLN A 101 ? ? -154.68 76.02 257 14 PHE A 103 ? ? -46.30 -19.29 258 14 GLN A 105 ? ? -56.40 -9.53 259 14 SER A 132 ? ? -57.24 2.89 260 14 GLU A 134 ? ? 178.61 -168.96 261 14 ARG A 152 ? ? -163.21 106.94 262 14 VAL A 154 ? ? -135.90 -32.24 263 14 ALA A 159 ? ? -81.95 35.23 264 15 THR A 16 ? ? -145.56 -45.79 265 15 ASP A 17 ? ? -156.64 41.93 266 15 ARG A 37 ? ? -67.36 5.68 267 15 ALA A 40 ? ? -57.42 -1.49 268 15 PHE A 44 ? ? -157.62 -157.73 269 15 TYR A 45 ? ? -67.43 60.42 270 15 ASN A 46 ? ? -171.81 -41.80 271 15 SER A 54 ? ? 56.81 16.28 272 15 THR A 63 ? ? -156.11 -35.42 273 15 ASP A 69 ? ? 50.70 98.43 274 15 ASP A 78 ? ? -66.25 4.63 275 15 HIS A 94 ? ? -79.20 -133.36 276 15 GLN A 101 ? ? -151.27 64.75 277 15 SER A 102 ? ? -56.48 175.24 278 15 ASP A 116 ? ? -58.31 -7.88 279 15 SER A 132 ? ? -58.84 3.26 280 15 GLU A 134 ? ? -172.78 -146.06 281 15 HIS A 145 ? ? -109.25 -122.34 282 15 ASN A 146 ? ? -73.83 49.16 283 15 VAL A 154 ? ? -138.34 -34.77 284 16 THR A 16 ? ? -154.55 -46.27 285 16 ASP A 17 ? ? -148.05 32.76 286 16 ARG A 37 ? ? -63.68 2.58 287 16 ALA A 40 ? ? -56.17 -3.61 288 16 ASP A 41 ? ? -95.43 30.17 289 16 PHE A 44 ? ? -166.70 -156.25 290 16 ASN A 46 ? ? -49.52 -11.25 291 16 SER A 54 ? ? 59.72 18.57 292 16 THR A 63 ? ? -153.73 -34.57 293 16 PRO A 81 ? ? -79.44 -161.39 294 16 HIS A 94 ? ? -61.34 -136.01 295 16 ARG A 100 ? ? 67.54 95.77 296 16 GLN A 101 ? ? -154.16 78.61 297 16 SER A 132 ? ? -59.49 2.53 298 16 GLU A 134 ? ? -173.27 -148.95 299 16 VAL A 154 ? ? -140.00 -35.67 300 16 ALA A 173 ? ? -80.43 -156.91 301 17 ASP A 17 ? ? 49.43 13.58 302 17 ARG A 37 ? ? -67.42 6.08 303 17 ALA A 40 ? ? -57.42 -0.91 304 17 THR A 63 ? ? -155.94 -34.59 305 17 ASP A 69 ? ? -50.04 106.19 306 17 PRO A 81 ? ? -78.05 -161.57 307 17 HIS A 94 ? ? -77.73 -154.43 308 17 ALA A 96 ? ? -47.77 -18.94 309 17 ARG A 99 ? ? -68.89 7.94 310 17 ARG A 100 ? ? 51.75 85.78 311 17 GLN A 101 ? ? -154.92 73.42 312 17 PHE A 103 ? ? -47.81 -14.92 313 17 THR A 128 ? ? -45.48 -17.89 314 17 SER A 132 ? ? -59.99 2.94 315 17 GLU A 134 ? ? -169.55 -150.22 316 17 ASN A 146 ? ? 54.29 10.18 317 17 VAL A 154 ? ? -147.97 -36.08 318 18 ASP A 17 ? ? -156.99 17.07 319 18 ASP A 20 ? ? -176.45 -164.52 320 18 ARG A 37 ? ? -66.13 4.45 321 18 ALA A 40 ? ? -56.96 -1.61 322 18 PHE A 44 ? ? -125.85 -166.86 323 18 SER A 54 ? ? 59.18 13.81 324 18 ASN A 61 ? ? -70.03 -169.39 325 18 THR A 63 ? ? -150.80 -35.31 326 18 ASP A 67 ? ? -79.66 45.60 327 18 LEU A 77 ? ? -55.10 -4.73 328 18 HIS A 94 ? ? -60.50 -149.25 329 18 ARG A 100 ? ? 60.94 89.98 330 18 GLN A 101 ? ? -153.46 81.14 331 18 PHE A 103 ? ? -45.45 -16.38 332 18 SER A 132 ? ? -53.84 -3.15 333 18 GLU A 134 ? ? -173.35 -145.47 334 18 VAL A 154 ? ? -149.38 -36.20 335 18 ALA A 173 ? ? -80.49 45.25 336 19 ASP A 17 ? ? -157.84 18.40 337 19 ASP A 20 ? ? -176.13 149.36 338 19 ARG A 37 ? ? -69.92 8.22 339 19 ALA A 40 ? ? -56.38 -2.45 340 19 PHE A 44 ? ? -166.37 -156.09 341 19 ASN A 46 ? ? -59.22 -2.39 342 19 SER A 54 ? ? 59.82 11.39 343 19 THR A 63 ? ? -153.40 -34.85 344 19 ASP A 69 ? ? 47.58 95.51 345 19 ASP A 78 ? ? -59.25 -0.25 346 19 PRO A 81 ? ? -76.33 -160.88 347 19 ASP A 83 ? ? -136.45 -56.58 348 19 HIS A 94 ? ? -62.00 -138.59 349 19 ALA A 96 ? ? -49.85 -19.30 350 19 ARG A 100 ? ? 62.46 90.94 351 19 GLN A 101 ? ? -155.92 67.82 352 19 SER A 102 ? ? -56.58 170.44 353 19 ASP A 116 ? ? -58.23 -7.36 354 19 ASP A 130 ? ? -88.98 -74.37 355 19 SER A 132 ? ? -43.16 -19.08 356 19 VAL A 154 ? ? -139.60 -33.63 357 19 ALA A 173 ? ? -80.51 48.15 358 20 MET A 2 ? ? -175.66 43.33 359 20 LYS A 3 ? ? -149.62 -45.16 360 20 ASP A 17 ? ? 48.66 12.51 361 20 ARG A 37 ? ? -64.11 2.38 362 20 ALA A 40 ? ? -56.24 -3.18 363 20 ASN A 46 ? ? -63.83 2.33 364 20 THR A 63 ? ? -154.54 -33.45 365 20 ASP A 69 ? ? -50.46 107.88 366 20 PRO A 81 ? ? -77.51 -161.53 367 20 HIS A 94 ? ? -73.27 -139.39 368 20 ARG A 100 ? ? 66.42 96.51 369 20 GLN A 101 ? ? -157.57 80.04 370 20 ASP A 116 ? ? -48.83 -14.48 371 20 SER A 132 ? ? -60.80 2.93 372 20 GLU A 134 ? ? -171.98 -147.52 373 20 VAL A 154 ? ? -139.75 -34.12 374 20 LEU A 162 ? ? -45.44 -16.80 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 500 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KXV _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KXV _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '20mM potassium phosphate-1, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample.component 'potassium phosphate-1' _pdbx_nmr_exptl_sample.concentration 20 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling ? _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.02 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCACB' 1 5 1 '3D HNCO' 1 6 1 '3D HN(CO)CA' 1 7 1 '3D C(CO)NH' 1 8 1 '3D 1H-15N NOESY' 1 9 1 '3D 1H-13C NOESY' 1 10 1 '3D HCCH-TOCSY' 1 11 1 '3D HBHA(CO)NH' 1 12 1 '3D HNHA' 1 13 1 '2D 1H-1H NOESY' # _pdbx_nmr_refine.entry_id 2KXV _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal ;Linge, O'Donoghue and Nilges ; 'data analysis' AURELIA 3.1.6 1 'Bruker Biospin' processing XwinNMR 3.5 2 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' ? 3 'Johnson, One Moon Scientific' 'chemical shift assignment' VNMR 5.0 4 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 5 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 6 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -17 ? A MET 1 2 1 Y 1 A SER -16 ? A SER 2 3 1 Y 1 A VAL -15 ? A VAL 3 4 1 Y 1 A SER -14 ? A SER 4 5 1 Y 1 A LEU -13 ? A LEU 5 6 1 Y 1 A SER -12 ? A SER 6 7 1 Y 1 A LYS -11 ? A LYS 7 8 1 Y 1 A GLY -10 ? A GLY 8 9 1 Y 1 A GLY -9 ? A GLY 9 10 1 Y 1 A ASN -8 ? A ASN 10 11 1 Y 1 A VAL -7 ? A VAL 11 12 1 Y 1 A SER -6 ? A SER 12 13 1 Y 1 A LEU -5 ? A LEU 13 14 1 Y 1 A SER -4 ? A SER 14 15 1 Y 1 A LYS -3 ? A LYS 15 16 1 Y 1 A THR -2 ? A THR 16 17 1 Y 1 A ALA -1 ? A ALA 17 18 1 Y 1 A PRO 0 ? A PRO 18 19 1 Y 1 A LEU 175 ? A LEU 193 20 1 Y 1 A GLU 176 ? A GLU 194 21 1 Y 1 A HIS 177 ? A HIS 195 22 1 Y 1 A HIS 178 ? A HIS 196 23 1 Y 1 A HIS 179 ? A HIS 197 24 1 Y 1 A HIS 180 ? A HIS 198 25 1 Y 1 A HIS 181 ? A HIS 199 26 1 Y 1 A HIS 182 ? A HIS 200 27 2 Y 1 A MET -17 ? A MET 1 28 2 Y 1 A SER -16 ? A SER 2 29 2 Y 1 A VAL -15 ? A VAL 3 30 2 Y 1 A SER -14 ? A SER 4 31 2 Y 1 A LEU -13 ? A LEU 5 32 2 Y 1 A SER -12 ? A SER 6 33 2 Y 1 A LYS -11 ? A LYS 7 34 2 Y 1 A GLY -10 ? A GLY 8 35 2 Y 1 A GLY -9 ? A GLY 9 36 2 Y 1 A ASN -8 ? A ASN 10 37 2 Y 1 A VAL -7 ? A VAL 11 38 2 Y 1 A SER -6 ? A SER 12 39 2 Y 1 A LEU -5 ? A LEU 13 40 2 Y 1 A SER -4 ? A SER 14 41 2 Y 1 A LYS -3 ? A LYS 15 42 2 Y 1 A THR -2 ? A THR 16 43 2 Y 1 A ALA -1 ? A ALA 17 44 2 Y 1 A PRO 0 ? A PRO 18 45 2 Y 1 A LEU 175 ? A LEU 193 46 2 Y 1 A GLU 176 ? A GLU 194 47 2 Y 1 A HIS 177 ? A HIS 195 48 2 Y 1 A HIS 178 ? A HIS 196 49 2 Y 1 A HIS 179 ? A HIS 197 50 2 Y 1 A HIS 180 ? A HIS 198 51 2 Y 1 A HIS 181 ? A HIS 199 52 2 Y 1 A HIS 182 ? A HIS 200 53 3 Y 1 A MET -17 ? A MET 1 54 3 Y 1 A SER -16 ? A SER 2 55 3 Y 1 A VAL -15 ? A VAL 3 56 3 Y 1 A SER -14 ? A SER 4 57 3 Y 1 A LEU -13 ? A LEU 5 58 3 Y 1 A SER -12 ? A SER 6 59 3 Y 1 A LYS -11 ? A LYS 7 60 3 Y 1 A GLY -10 ? A GLY 8 61 3 Y 1 A GLY -9 ? A GLY 9 62 3 Y 1 A ASN -8 ? A ASN 10 63 3 Y 1 A VAL -7 ? A VAL 11 64 3 Y 1 A SER -6 ? A SER 12 65 3 Y 1 A LEU -5 ? A LEU 13 66 3 Y 1 A SER -4 ? A SER 14 67 3 Y 1 A LYS -3 ? A LYS 15 68 3 Y 1 A THR -2 ? A THR 16 69 3 Y 1 A ALA -1 ? A ALA 17 70 3 Y 1 A PRO 0 ? A PRO 18 71 3 Y 1 A LEU 175 ? A LEU 193 72 3 Y 1 A GLU 176 ? A GLU 194 73 3 Y 1 A HIS 177 ? A HIS 195 74 3 Y 1 A HIS 178 ? A HIS 196 75 3 Y 1 A HIS 179 ? A HIS 197 76 3 Y 1 A HIS 180 ? A HIS 198 77 3 Y 1 A HIS 181 ? A HIS 199 78 3 Y 1 A HIS 182 ? A HIS 200 79 4 Y 1 A MET -17 ? A MET 1 80 4 Y 1 A SER -16 ? A SER 2 81 4 Y 1 A VAL -15 ? A VAL 3 82 4 Y 1 A SER -14 ? A SER 4 83 4 Y 1 A LEU -13 ? A LEU 5 84 4 Y 1 A SER -12 ? A SER 6 85 4 Y 1 A LYS -11 ? A LYS 7 86 4 Y 1 A GLY -10 ? A GLY 8 87 4 Y 1 A GLY -9 ? A GLY 9 88 4 Y 1 A ASN -8 ? A ASN 10 89 4 Y 1 A VAL -7 ? A VAL 11 90 4 Y 1 A SER -6 ? A SER 12 91 4 Y 1 A LEU -5 ? A LEU 13 92 4 Y 1 A SER -4 ? A SER 14 93 4 Y 1 A LYS -3 ? A LYS 15 94 4 Y 1 A THR -2 ? A THR 16 95 4 Y 1 A ALA -1 ? A ALA 17 96 4 Y 1 A PRO 0 ? A PRO 18 97 4 Y 1 A LEU 175 ? A LEU 193 98 4 Y 1 A GLU 176 ? A GLU 194 99 4 Y 1 A HIS 177 ? A HIS 195 100 4 Y 1 A HIS 178 ? A HIS 196 101 4 Y 1 A HIS 179 ? A HIS 197 102 4 Y 1 A HIS 180 ? A HIS 198 103 4 Y 1 A HIS 181 ? A HIS 199 104 4 Y 1 A HIS 182 ? A HIS 200 105 5 Y 1 A MET -17 ? A MET 1 106 5 Y 1 A SER -16 ? A SER 2 107 5 Y 1 A VAL -15 ? A VAL 3 108 5 Y 1 A SER -14 ? A SER 4 109 5 Y 1 A LEU -13 ? A LEU 5 110 5 Y 1 A SER -12 ? A SER 6 111 5 Y 1 A LYS -11 ? A LYS 7 112 5 Y 1 A GLY -10 ? A GLY 8 113 5 Y 1 A GLY -9 ? A GLY 9 114 5 Y 1 A ASN -8 ? A ASN 10 115 5 Y 1 A VAL -7 ? A VAL 11 116 5 Y 1 A SER -6 ? A SER 12 117 5 Y 1 A LEU -5 ? A LEU 13 118 5 Y 1 A SER -4 ? A SER 14 119 5 Y 1 A LYS -3 ? A LYS 15 120 5 Y 1 A THR -2 ? A THR 16 121 5 Y 1 A ALA -1 ? A ALA 17 122 5 Y 1 A PRO 0 ? A PRO 18 123 5 Y 1 A LEU 175 ? A LEU 193 124 5 Y 1 A GLU 176 ? A GLU 194 125 5 Y 1 A HIS 177 ? A HIS 195 126 5 Y 1 A HIS 178 ? A HIS 196 127 5 Y 1 A HIS 179 ? A HIS 197 128 5 Y 1 A HIS 180 ? A HIS 198 129 5 Y 1 A HIS 181 ? A HIS 199 130 5 Y 1 A HIS 182 ? A HIS 200 131 6 Y 1 A MET -17 ? A MET 1 132 6 Y 1 A SER -16 ? A SER 2 133 6 Y 1 A VAL -15 ? A VAL 3 134 6 Y 1 A SER -14 ? A SER 4 135 6 Y 1 A LEU -13 ? A LEU 5 136 6 Y 1 A SER -12 ? A SER 6 137 6 Y 1 A LYS -11 ? A LYS 7 138 6 Y 1 A GLY -10 ? A GLY 8 139 6 Y 1 A GLY -9 ? A GLY 9 140 6 Y 1 A ASN -8 ? A ASN 10 141 6 Y 1 A VAL -7 ? A VAL 11 142 6 Y 1 A SER -6 ? A SER 12 143 6 Y 1 A LEU -5 ? A LEU 13 144 6 Y 1 A SER -4 ? A SER 14 145 6 Y 1 A LYS -3 ? A LYS 15 146 6 Y 1 A THR -2 ? A THR 16 147 6 Y 1 A ALA -1 ? A ALA 17 148 6 Y 1 A PRO 0 ? A PRO 18 149 6 Y 1 A LEU 175 ? A LEU 193 150 6 Y 1 A GLU 176 ? A GLU 194 151 6 Y 1 A HIS 177 ? A HIS 195 152 6 Y 1 A HIS 178 ? A HIS 196 153 6 Y 1 A HIS 179 ? A HIS 197 154 6 Y 1 A HIS 180 ? A HIS 198 155 6 Y 1 A HIS 181 ? A HIS 199 156 6 Y 1 A HIS 182 ? A HIS 200 157 7 Y 1 A MET -17 ? A MET 1 158 7 Y 1 A SER -16 ? A SER 2 159 7 Y 1 A VAL -15 ? A VAL 3 160 7 Y 1 A SER -14 ? A SER 4 161 7 Y 1 A LEU -13 ? A LEU 5 162 7 Y 1 A SER -12 ? A SER 6 163 7 Y 1 A LYS -11 ? A LYS 7 164 7 Y 1 A GLY -10 ? A GLY 8 165 7 Y 1 A GLY -9 ? A GLY 9 166 7 Y 1 A ASN -8 ? A ASN 10 167 7 Y 1 A VAL -7 ? A VAL 11 168 7 Y 1 A SER -6 ? A SER 12 169 7 Y 1 A LEU -5 ? A LEU 13 170 7 Y 1 A SER -4 ? A SER 14 171 7 Y 1 A LYS -3 ? A LYS 15 172 7 Y 1 A THR -2 ? A THR 16 173 7 Y 1 A ALA -1 ? A ALA 17 174 7 Y 1 A PRO 0 ? A PRO 18 175 7 Y 1 A LEU 175 ? A LEU 193 176 7 Y 1 A GLU 176 ? A GLU 194 177 7 Y 1 A HIS 177 ? A HIS 195 178 7 Y 1 A HIS 178 ? A HIS 196 179 7 Y 1 A HIS 179 ? A HIS 197 180 7 Y 1 A HIS 180 ? A HIS 198 181 7 Y 1 A HIS 181 ? A HIS 199 182 7 Y 1 A HIS 182 ? A HIS 200 183 8 Y 1 A MET -17 ? A MET 1 184 8 Y 1 A SER -16 ? A SER 2 185 8 Y 1 A VAL -15 ? A VAL 3 186 8 Y 1 A SER -14 ? A SER 4 187 8 Y 1 A LEU -13 ? A LEU 5 188 8 Y 1 A SER -12 ? A SER 6 189 8 Y 1 A LYS -11 ? A LYS 7 190 8 Y 1 A GLY -10 ? A GLY 8 191 8 Y 1 A GLY -9 ? A GLY 9 192 8 Y 1 A ASN -8 ? A ASN 10 193 8 Y 1 A VAL -7 ? A VAL 11 194 8 Y 1 A SER -6 ? A SER 12 195 8 Y 1 A LEU -5 ? A LEU 13 196 8 Y 1 A SER -4 ? A SER 14 197 8 Y 1 A LYS -3 ? A LYS 15 198 8 Y 1 A THR -2 ? A THR 16 199 8 Y 1 A ALA -1 ? A ALA 17 200 8 Y 1 A PRO 0 ? A PRO 18 201 8 Y 1 A LEU 175 ? A LEU 193 202 8 Y 1 A GLU 176 ? A GLU 194 203 8 Y 1 A HIS 177 ? A HIS 195 204 8 Y 1 A HIS 178 ? A HIS 196 205 8 Y 1 A HIS 179 ? A HIS 197 206 8 Y 1 A HIS 180 ? A HIS 198 207 8 Y 1 A HIS 181 ? A HIS 199 208 8 Y 1 A HIS 182 ? A HIS 200 209 9 Y 1 A MET -17 ? A MET 1 210 9 Y 1 A SER -16 ? A SER 2 211 9 Y 1 A VAL -15 ? A VAL 3 212 9 Y 1 A SER -14 ? A SER 4 213 9 Y 1 A LEU -13 ? A LEU 5 214 9 Y 1 A SER -12 ? A SER 6 215 9 Y 1 A LYS -11 ? A LYS 7 216 9 Y 1 A GLY -10 ? A GLY 8 217 9 Y 1 A GLY -9 ? A GLY 9 218 9 Y 1 A ASN -8 ? A ASN 10 219 9 Y 1 A VAL -7 ? A VAL 11 220 9 Y 1 A SER -6 ? A SER 12 221 9 Y 1 A LEU -5 ? A LEU 13 222 9 Y 1 A SER -4 ? A SER 14 223 9 Y 1 A LYS -3 ? A LYS 15 224 9 Y 1 A THR -2 ? A THR 16 225 9 Y 1 A ALA -1 ? A ALA 17 226 9 Y 1 A PRO 0 ? A PRO 18 227 9 Y 1 A LEU 175 ? A LEU 193 228 9 Y 1 A GLU 176 ? A GLU 194 229 9 Y 1 A HIS 177 ? A HIS 195 230 9 Y 1 A HIS 178 ? A HIS 196 231 9 Y 1 A HIS 179 ? A HIS 197 232 9 Y 1 A HIS 180 ? A HIS 198 233 9 Y 1 A HIS 181 ? A HIS 199 234 9 Y 1 A HIS 182 ? A HIS 200 235 10 Y 1 A MET -17 ? A MET 1 236 10 Y 1 A SER -16 ? A SER 2 237 10 Y 1 A VAL -15 ? A VAL 3 238 10 Y 1 A SER -14 ? A SER 4 239 10 Y 1 A LEU -13 ? A LEU 5 240 10 Y 1 A SER -12 ? A SER 6 241 10 Y 1 A LYS -11 ? A LYS 7 242 10 Y 1 A GLY -10 ? A GLY 8 243 10 Y 1 A GLY -9 ? A GLY 9 244 10 Y 1 A ASN -8 ? A ASN 10 245 10 Y 1 A VAL -7 ? A VAL 11 246 10 Y 1 A SER -6 ? A SER 12 247 10 Y 1 A LEU -5 ? A LEU 13 248 10 Y 1 A SER -4 ? A SER 14 249 10 Y 1 A LYS -3 ? A LYS 15 250 10 Y 1 A THR -2 ? A THR 16 251 10 Y 1 A ALA -1 ? A ALA 17 252 10 Y 1 A PRO 0 ? A PRO 18 253 10 Y 1 A LEU 175 ? A LEU 193 254 10 Y 1 A GLU 176 ? A GLU 194 255 10 Y 1 A HIS 177 ? A HIS 195 256 10 Y 1 A HIS 178 ? A HIS 196 257 10 Y 1 A HIS 179 ? A HIS 197 258 10 Y 1 A HIS 180 ? A HIS 198 259 10 Y 1 A HIS 181 ? A HIS 199 260 10 Y 1 A HIS 182 ? A HIS 200 261 11 Y 1 A MET -17 ? A MET 1 262 11 Y 1 A SER -16 ? A SER 2 263 11 Y 1 A VAL -15 ? A VAL 3 264 11 Y 1 A SER -14 ? A SER 4 265 11 Y 1 A LEU -13 ? A LEU 5 266 11 Y 1 A SER -12 ? A SER 6 267 11 Y 1 A LYS -11 ? A LYS 7 268 11 Y 1 A GLY -10 ? A GLY 8 269 11 Y 1 A GLY -9 ? A GLY 9 270 11 Y 1 A ASN -8 ? A ASN 10 271 11 Y 1 A VAL -7 ? A VAL 11 272 11 Y 1 A SER -6 ? A SER 12 273 11 Y 1 A LEU -5 ? A LEU 13 274 11 Y 1 A SER -4 ? A SER 14 275 11 Y 1 A LYS -3 ? A LYS 15 276 11 Y 1 A THR -2 ? A THR 16 277 11 Y 1 A ALA -1 ? A ALA 17 278 11 Y 1 A PRO 0 ? A PRO 18 279 11 Y 1 A LEU 175 ? A LEU 193 280 11 Y 1 A GLU 176 ? A GLU 194 281 11 Y 1 A HIS 177 ? A HIS 195 282 11 Y 1 A HIS 178 ? A HIS 196 283 11 Y 1 A HIS 179 ? A HIS 197 284 11 Y 1 A HIS 180 ? A HIS 198 285 11 Y 1 A HIS 181 ? A HIS 199 286 11 Y 1 A HIS 182 ? A HIS 200 287 12 Y 1 A MET -17 ? A MET 1 288 12 Y 1 A SER -16 ? A SER 2 289 12 Y 1 A VAL -15 ? A VAL 3 290 12 Y 1 A SER -14 ? A SER 4 291 12 Y 1 A LEU -13 ? A LEU 5 292 12 Y 1 A SER -12 ? A SER 6 293 12 Y 1 A LYS -11 ? A LYS 7 294 12 Y 1 A GLY -10 ? A GLY 8 295 12 Y 1 A GLY -9 ? A GLY 9 296 12 Y 1 A ASN -8 ? A ASN 10 297 12 Y 1 A VAL -7 ? A VAL 11 298 12 Y 1 A SER -6 ? A SER 12 299 12 Y 1 A LEU -5 ? A LEU 13 300 12 Y 1 A SER -4 ? A SER 14 301 12 Y 1 A LYS -3 ? A LYS 15 302 12 Y 1 A THR -2 ? A THR 16 303 12 Y 1 A ALA -1 ? A ALA 17 304 12 Y 1 A PRO 0 ? A PRO 18 305 12 Y 1 A LEU 175 ? A LEU 193 306 12 Y 1 A GLU 176 ? A GLU 194 307 12 Y 1 A HIS 177 ? A HIS 195 308 12 Y 1 A HIS 178 ? A HIS 196 309 12 Y 1 A HIS 179 ? A HIS 197 310 12 Y 1 A HIS 180 ? A HIS 198 311 12 Y 1 A HIS 181 ? A HIS 199 312 12 Y 1 A HIS 182 ? A HIS 200 313 13 Y 1 A MET -17 ? A MET 1 314 13 Y 1 A SER -16 ? A SER 2 315 13 Y 1 A VAL -15 ? A VAL 3 316 13 Y 1 A SER -14 ? A SER 4 317 13 Y 1 A LEU -13 ? A LEU 5 318 13 Y 1 A SER -12 ? A SER 6 319 13 Y 1 A LYS -11 ? A LYS 7 320 13 Y 1 A GLY -10 ? A GLY 8 321 13 Y 1 A GLY -9 ? A GLY 9 322 13 Y 1 A ASN -8 ? A ASN 10 323 13 Y 1 A VAL -7 ? A VAL 11 324 13 Y 1 A SER -6 ? A SER 12 325 13 Y 1 A LEU -5 ? A LEU 13 326 13 Y 1 A SER -4 ? A SER 14 327 13 Y 1 A LYS -3 ? A LYS 15 328 13 Y 1 A THR -2 ? A THR 16 329 13 Y 1 A ALA -1 ? A ALA 17 330 13 Y 1 A PRO 0 ? A PRO 18 331 13 Y 1 A LEU 175 ? A LEU 193 332 13 Y 1 A GLU 176 ? A GLU 194 333 13 Y 1 A HIS 177 ? A HIS 195 334 13 Y 1 A HIS 178 ? A HIS 196 335 13 Y 1 A HIS 179 ? A HIS 197 336 13 Y 1 A HIS 180 ? A HIS 198 337 13 Y 1 A HIS 181 ? A HIS 199 338 13 Y 1 A HIS 182 ? A HIS 200 339 14 Y 1 A MET -17 ? A MET 1 340 14 Y 1 A SER -16 ? A SER 2 341 14 Y 1 A VAL -15 ? A VAL 3 342 14 Y 1 A SER -14 ? A SER 4 343 14 Y 1 A LEU -13 ? A LEU 5 344 14 Y 1 A SER -12 ? A SER 6 345 14 Y 1 A LYS -11 ? A LYS 7 346 14 Y 1 A GLY -10 ? A GLY 8 347 14 Y 1 A GLY -9 ? A GLY 9 348 14 Y 1 A ASN -8 ? A ASN 10 349 14 Y 1 A VAL -7 ? A VAL 11 350 14 Y 1 A SER -6 ? A SER 12 351 14 Y 1 A LEU -5 ? A LEU 13 352 14 Y 1 A SER -4 ? A SER 14 353 14 Y 1 A LYS -3 ? A LYS 15 354 14 Y 1 A THR -2 ? A THR 16 355 14 Y 1 A ALA -1 ? A ALA 17 356 14 Y 1 A PRO 0 ? A PRO 18 357 14 Y 1 A LEU 175 ? A LEU 193 358 14 Y 1 A GLU 176 ? A GLU 194 359 14 Y 1 A HIS 177 ? A HIS 195 360 14 Y 1 A HIS 178 ? A HIS 196 361 14 Y 1 A HIS 179 ? A HIS 197 362 14 Y 1 A HIS 180 ? A HIS 198 363 14 Y 1 A HIS 181 ? A HIS 199 364 14 Y 1 A HIS 182 ? A HIS 200 365 15 Y 1 A MET -17 ? A MET 1 366 15 Y 1 A SER -16 ? A SER 2 367 15 Y 1 A VAL -15 ? A VAL 3 368 15 Y 1 A SER -14 ? A SER 4 369 15 Y 1 A LEU -13 ? A LEU 5 370 15 Y 1 A SER -12 ? A SER 6 371 15 Y 1 A LYS -11 ? A LYS 7 372 15 Y 1 A GLY -10 ? A GLY 8 373 15 Y 1 A GLY -9 ? A GLY 9 374 15 Y 1 A ASN -8 ? A ASN 10 375 15 Y 1 A VAL -7 ? A VAL 11 376 15 Y 1 A SER -6 ? A SER 12 377 15 Y 1 A LEU -5 ? A LEU 13 378 15 Y 1 A SER -4 ? A SER 14 379 15 Y 1 A LYS -3 ? A LYS 15 380 15 Y 1 A THR -2 ? A THR 16 381 15 Y 1 A ALA -1 ? A ALA 17 382 15 Y 1 A PRO 0 ? A PRO 18 383 15 Y 1 A LEU 175 ? A LEU 193 384 15 Y 1 A GLU 176 ? A GLU 194 385 15 Y 1 A HIS 177 ? A HIS 195 386 15 Y 1 A HIS 178 ? A HIS 196 387 15 Y 1 A HIS 179 ? A HIS 197 388 15 Y 1 A HIS 180 ? A HIS 198 389 15 Y 1 A HIS 181 ? A HIS 199 390 15 Y 1 A HIS 182 ? A HIS 200 391 16 Y 1 A MET -17 ? A MET 1 392 16 Y 1 A SER -16 ? A SER 2 393 16 Y 1 A VAL -15 ? A VAL 3 394 16 Y 1 A SER -14 ? A SER 4 395 16 Y 1 A LEU -13 ? A LEU 5 396 16 Y 1 A SER -12 ? A SER 6 397 16 Y 1 A LYS -11 ? A LYS 7 398 16 Y 1 A GLY -10 ? A GLY 8 399 16 Y 1 A GLY -9 ? A GLY 9 400 16 Y 1 A ASN -8 ? A ASN 10 401 16 Y 1 A VAL -7 ? A VAL 11 402 16 Y 1 A SER -6 ? A SER 12 403 16 Y 1 A LEU -5 ? A LEU 13 404 16 Y 1 A SER -4 ? A SER 14 405 16 Y 1 A LYS -3 ? A LYS 15 406 16 Y 1 A THR -2 ? A THR 16 407 16 Y 1 A ALA -1 ? A ALA 17 408 16 Y 1 A PRO 0 ? A PRO 18 409 16 Y 1 A LEU 175 ? A LEU 193 410 16 Y 1 A GLU 176 ? A GLU 194 411 16 Y 1 A HIS 177 ? A HIS 195 412 16 Y 1 A HIS 178 ? A HIS 196 413 16 Y 1 A HIS 179 ? A HIS 197 414 16 Y 1 A HIS 180 ? A HIS 198 415 16 Y 1 A HIS 181 ? A HIS 199 416 16 Y 1 A HIS 182 ? A HIS 200 417 17 Y 1 A MET -17 ? A MET 1 418 17 Y 1 A SER -16 ? A SER 2 419 17 Y 1 A VAL -15 ? A VAL 3 420 17 Y 1 A SER -14 ? A SER 4 421 17 Y 1 A LEU -13 ? A LEU 5 422 17 Y 1 A SER -12 ? A SER 6 423 17 Y 1 A LYS -11 ? A LYS 7 424 17 Y 1 A GLY -10 ? A GLY 8 425 17 Y 1 A GLY -9 ? A GLY 9 426 17 Y 1 A ASN -8 ? A ASN 10 427 17 Y 1 A VAL -7 ? A VAL 11 428 17 Y 1 A SER -6 ? A SER 12 429 17 Y 1 A LEU -5 ? A LEU 13 430 17 Y 1 A SER -4 ? A SER 14 431 17 Y 1 A LYS -3 ? A LYS 15 432 17 Y 1 A THR -2 ? A THR 16 433 17 Y 1 A ALA -1 ? A ALA 17 434 17 Y 1 A PRO 0 ? A PRO 18 435 17 Y 1 A LEU 175 ? A LEU 193 436 17 Y 1 A GLU 176 ? A GLU 194 437 17 Y 1 A HIS 177 ? A HIS 195 438 17 Y 1 A HIS 178 ? A HIS 196 439 17 Y 1 A HIS 179 ? A HIS 197 440 17 Y 1 A HIS 180 ? A HIS 198 441 17 Y 1 A HIS 181 ? A HIS 199 442 17 Y 1 A HIS 182 ? A HIS 200 443 18 Y 1 A MET -17 ? A MET 1 444 18 Y 1 A SER -16 ? A SER 2 445 18 Y 1 A VAL -15 ? A VAL 3 446 18 Y 1 A SER -14 ? A SER 4 447 18 Y 1 A LEU -13 ? A LEU 5 448 18 Y 1 A SER -12 ? A SER 6 449 18 Y 1 A LYS -11 ? A LYS 7 450 18 Y 1 A GLY -10 ? A GLY 8 451 18 Y 1 A GLY -9 ? A GLY 9 452 18 Y 1 A ASN -8 ? A ASN 10 453 18 Y 1 A VAL -7 ? A VAL 11 454 18 Y 1 A SER -6 ? A SER 12 455 18 Y 1 A LEU -5 ? A LEU 13 456 18 Y 1 A SER -4 ? A SER 14 457 18 Y 1 A LYS -3 ? A LYS 15 458 18 Y 1 A THR -2 ? A THR 16 459 18 Y 1 A ALA -1 ? A ALA 17 460 18 Y 1 A PRO 0 ? A PRO 18 461 18 Y 1 A LEU 175 ? A LEU 193 462 18 Y 1 A GLU 176 ? A GLU 194 463 18 Y 1 A HIS 177 ? A HIS 195 464 18 Y 1 A HIS 178 ? A HIS 196 465 18 Y 1 A HIS 179 ? A HIS 197 466 18 Y 1 A HIS 180 ? A HIS 198 467 18 Y 1 A HIS 181 ? A HIS 199 468 18 Y 1 A HIS 182 ? A HIS 200 469 19 Y 1 A MET -17 ? A MET 1 470 19 Y 1 A SER -16 ? A SER 2 471 19 Y 1 A VAL -15 ? A VAL 3 472 19 Y 1 A SER -14 ? A SER 4 473 19 Y 1 A LEU -13 ? A LEU 5 474 19 Y 1 A SER -12 ? A SER 6 475 19 Y 1 A LYS -11 ? A LYS 7 476 19 Y 1 A GLY -10 ? A GLY 8 477 19 Y 1 A GLY -9 ? A GLY 9 478 19 Y 1 A ASN -8 ? A ASN 10 479 19 Y 1 A VAL -7 ? A VAL 11 480 19 Y 1 A SER -6 ? A SER 12 481 19 Y 1 A LEU -5 ? A LEU 13 482 19 Y 1 A SER -4 ? A SER 14 483 19 Y 1 A LYS -3 ? A LYS 15 484 19 Y 1 A THR -2 ? A THR 16 485 19 Y 1 A ALA -1 ? A ALA 17 486 19 Y 1 A PRO 0 ? A PRO 18 487 19 Y 1 A LEU 175 ? A LEU 193 488 19 Y 1 A GLU 176 ? A GLU 194 489 19 Y 1 A HIS 177 ? A HIS 195 490 19 Y 1 A HIS 178 ? A HIS 196 491 19 Y 1 A HIS 179 ? A HIS 197 492 19 Y 1 A HIS 180 ? A HIS 198 493 19 Y 1 A HIS 181 ? A HIS 199 494 19 Y 1 A HIS 182 ? A HIS 200 495 20 Y 1 A MET -17 ? A MET 1 496 20 Y 1 A SER -16 ? A SER 2 497 20 Y 1 A VAL -15 ? A VAL 3 498 20 Y 1 A SER -14 ? A SER 4 499 20 Y 1 A LEU -13 ? A LEU 5 500 20 Y 1 A SER -12 ? A SER 6 501 20 Y 1 A LYS -11 ? A LYS 7 502 20 Y 1 A GLY -10 ? A GLY 8 503 20 Y 1 A GLY -9 ? A GLY 9 504 20 Y 1 A ASN -8 ? A ASN 10 505 20 Y 1 A VAL -7 ? A VAL 11 506 20 Y 1 A SER -6 ? A SER 12 507 20 Y 1 A LEU -5 ? A LEU 13 508 20 Y 1 A SER -4 ? A SER 14 509 20 Y 1 A LYS -3 ? A LYS 15 510 20 Y 1 A THR -2 ? A THR 16 511 20 Y 1 A ALA -1 ? A ALA 17 512 20 Y 1 A PRO 0 ? A PRO 18 513 20 Y 1 A LEU 175 ? A LEU 193 514 20 Y 1 A GLU 176 ? A GLU 194 515 20 Y 1 A HIS 177 ? A HIS 195 516 20 Y 1 A HIS 178 ? A HIS 196 517 20 Y 1 A HIS 179 ? A HIS 197 518 20 Y 1 A HIS 180 ? A HIS 198 519 20 Y 1 A HIS 181 ? A HIS 199 520 20 Y 1 A HIS 182 ? A HIS 200 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 ILE N N N N 159 ILE CA C N S 160 ILE C C N N 161 ILE O O N N 162 ILE CB C N S 163 ILE CG1 C N N 164 ILE CG2 C N N 165 ILE CD1 C N N 166 ILE OXT O N N 167 ILE H H N N 168 ILE H2 H N N 169 ILE HA H N N 170 ILE HB H N N 171 ILE HG12 H N N 172 ILE HG13 H N N 173 ILE HG21 H N N 174 ILE HG22 H N N 175 ILE HG23 H N N 176 ILE HD11 H N N 177 ILE HD12 H N N 178 ILE HD13 H N N 179 ILE HXT H N N 180 LEU N N N N 181 LEU CA C N S 182 LEU C C N N 183 LEU O O N N 184 LEU CB C N N 185 LEU CG C N N 186 LEU CD1 C N N 187 LEU CD2 C N N 188 LEU OXT O N N 189 LEU H H N N 190 LEU H2 H N N 191 LEU HA H N N 192 LEU HB2 H N N 193 LEU HB3 H N N 194 LEU HG H N N 195 LEU HD11 H N N 196 LEU HD12 H N N 197 LEU HD13 H N N 198 LEU HD21 H N N 199 LEU HD22 H N N 200 LEU HD23 H N N 201 LEU HXT H N N 202 LYS N N N N 203 LYS CA C N S 204 LYS C C N N 205 LYS O O N N 206 LYS CB C N N 207 LYS CG C N N 208 LYS CD C N N 209 LYS CE C N N 210 LYS NZ N N N 211 LYS OXT O N N 212 LYS H H N N 213 LYS H2 H N N 214 LYS HA H N N 215 LYS HB2 H N N 216 LYS HB3 H N N 217 LYS HG2 H N N 218 LYS HG3 H N N 219 LYS HD2 H N N 220 LYS HD3 H N N 221 LYS HE2 H N N 222 LYS HE3 H N N 223 LYS HZ1 H N N 224 LYS HZ2 H N N 225 LYS HZ3 H N N 226 LYS HXT H N N 227 MET N N N N 228 MET CA C N S 229 MET C C N N 230 MET O O N N 231 MET CB C N N 232 MET CG C N N 233 MET SD S N N 234 MET CE C N N 235 MET OXT O N N 236 MET H H N N 237 MET H2 H N N 238 MET HA H N N 239 MET HB2 H N N 240 MET HB3 H N N 241 MET HG2 H N N 242 MET HG3 H N N 243 MET HE1 H N N 244 MET HE2 H N N 245 MET HE3 H N N 246 MET HXT H N N 247 PHE N N N N 248 PHE CA C N S 249 PHE C C N N 250 PHE O O N N 251 PHE CB C N N 252 PHE CG C Y N 253 PHE CD1 C Y N 254 PHE CD2 C Y N 255 PHE CE1 C Y N 256 PHE CE2 C Y N 257 PHE CZ C Y N 258 PHE OXT O N N 259 PHE H H N N 260 PHE H2 H N N 261 PHE HA H N N 262 PHE HB2 H N N 263 PHE HB3 H N N 264 PHE HD1 H N N 265 PHE HD2 H N N 266 PHE HE1 H N N 267 PHE HE2 H N N 268 PHE HZ H N N 269 PHE HXT H N N 270 PRO N N N N 271 PRO CA C N S 272 PRO C C N N 273 PRO O O N N 274 PRO CB C N N 275 PRO CG C N N 276 PRO CD C N N 277 PRO OXT O N N 278 PRO H H N N 279 PRO HA H N N 280 PRO HB2 H N N 281 PRO HB3 H N N 282 PRO HG2 H N N 283 PRO HG3 H N N 284 PRO HD2 H N N 285 PRO HD3 H N N 286 PRO HXT H N N 287 SER N N N N 288 SER CA C N S 289 SER C C N N 290 SER O O N N 291 SER CB C N N 292 SER OG O N N 293 SER OXT O N N 294 SER H H N N 295 SER H2 H N N 296 SER HA H N N 297 SER HB2 H N N 298 SER HB3 H N N 299 SER HG H N N 300 SER HXT H N N 301 THR N N N N 302 THR CA C N S 303 THR C C N N 304 THR O O N N 305 THR CB C N R 306 THR OG1 O N N 307 THR CG2 C N N 308 THR OXT O N N 309 THR H H N N 310 THR H2 H N N 311 THR HA H N N 312 THR HB H N N 313 THR HG1 H N N 314 THR HG21 H N N 315 THR HG22 H N N 316 THR HG23 H N N 317 THR HXT H N N 318 TRP N N N N 319 TRP CA C N S 320 TRP C C N N 321 TRP O O N N 322 TRP CB C N N 323 TRP CG C Y N 324 TRP CD1 C Y N 325 TRP CD2 C Y N 326 TRP NE1 N Y N 327 TRP CE2 C Y N 328 TRP CE3 C Y N 329 TRP CZ2 C Y N 330 TRP CZ3 C Y N 331 TRP CH2 C Y N 332 TRP OXT O N N 333 TRP H H N N 334 TRP H2 H N N 335 TRP HA H N N 336 TRP HB2 H N N 337 TRP HB3 H N N 338 TRP HD1 H N N 339 TRP HE1 H N N 340 TRP HE3 H N N 341 TRP HZ2 H N N 342 TRP HZ3 H N N 343 TRP HH2 H N N 344 TRP HXT H N N 345 TYR N N N N 346 TYR CA C N S 347 TYR C C N N 348 TYR O O N N 349 TYR CB C N N 350 TYR CG C Y N 351 TYR CD1 C Y N 352 TYR CD2 C Y N 353 TYR CE1 C Y N 354 TYR CE2 C Y N 355 TYR CZ C Y N 356 TYR OH O N N 357 TYR OXT O N N 358 TYR H H N N 359 TYR H2 H N N 360 TYR HA H N N 361 TYR HB2 H N N 362 TYR HB3 H N N 363 TYR HD1 H N N 364 TYR HD2 H N N 365 TYR HE1 H N N 366 TYR HE2 H N N 367 TYR HH H N N 368 TYR HXT H N N 369 VAL N N N N 370 VAL CA C N S 371 VAL C C N N 372 VAL O O N N 373 VAL CB C N N 374 VAL CG1 C N N 375 VAL CG2 C N N 376 VAL OXT O N N 377 VAL H H N N 378 VAL H2 H N N 379 VAL HA H N N 380 VAL HB H N N 381 VAL HG11 H N N 382 VAL HG12 H N N 383 VAL HG13 H N N 384 VAL HG21 H N N 385 VAL HG22 H N N 386 VAL HG23 H N N 387 VAL HXT H N N 388 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2KXV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_