data_2KXY # _entry.id 2KXY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KXY pdb_00002kxy 10.2210/pdb2kxy/pdb RCSB RCSB101712 ? ? WWPDB D_1000101712 ? ? BMRB 16927 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type TargetDB SuR18C . unspecified BMRB 16927 . unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KXY _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-05-13 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, Y.' 1 'Lee, H.' 2 'Belote, R.' 3 'Ciccosanti, C.' 4 'Hamilton, K.' 5 'Acton, T.' 6 'Xiao, R.' 7 'Everett, J.' 8 'Montelione, G.' 9 'Prestegard, J.' 10 'Northeast Structural Genomics Consortium (NESG)' 11 # _citation.id primary _citation.title 'Solution structure of SuR18C from Streptococcus thermophilus. Northeast Structural Genomics Consortium Target SuR18C' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, Y.' 1 ? primary 'Lee, H.' 2 ? primary 'Belote, R.' 3 ? primary 'Ciccosanti, C.' 4 ? primary 'Hamilton, K.' 5 ? primary 'Acton, T.' 6 ? primary 'Xiao, R.' 7 ? primary 'Everett, J.' 8 ? primary 'Montelione, G.' 9 ? primary 'Prestegard, J.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Uncharacterized protein' _entity.formula_weight 11015.523 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'sequence database residues 230-321' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;KISLRKLSKSVPVKLELTGDKASNVSSISYSFDRGHVTIVGSQEAMDKIDSITVPVDISQVTEDTSKTLELKAEGVTVQP STVKVNLKVTQKLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;KISLRKLSKSVPVKLELTGDKASNVSSISYSFDRGHVTIVGSQEAMDKIDSITVPVDISQVTEDTSKTLELKAEGVTVQP STVKVNLKVTQKLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier SuR18C # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 ILE n 1 3 SER n 1 4 LEU n 1 5 ARG n 1 6 LYS n 1 7 LEU n 1 8 SER n 1 9 LYS n 1 10 SER n 1 11 VAL n 1 12 PRO n 1 13 VAL n 1 14 LYS n 1 15 LEU n 1 16 GLU n 1 17 LEU n 1 18 THR n 1 19 GLY n 1 20 ASP n 1 21 LYS n 1 22 ALA n 1 23 SER n 1 24 ASN n 1 25 VAL n 1 26 SER n 1 27 SER n 1 28 ILE n 1 29 SER n 1 30 TYR n 1 31 SER n 1 32 PHE n 1 33 ASP n 1 34 ARG n 1 35 GLY n 1 36 HIS n 1 37 VAL n 1 38 THR n 1 39 ILE n 1 40 VAL n 1 41 GLY n 1 42 SER n 1 43 GLN n 1 44 GLU n 1 45 ALA n 1 46 MET n 1 47 ASP n 1 48 LYS n 1 49 ILE n 1 50 ASP n 1 51 SER n 1 52 ILE n 1 53 THR n 1 54 VAL n 1 55 PRO n 1 56 VAL n 1 57 ASP n 1 58 ILE n 1 59 SER n 1 60 GLN n 1 61 VAL n 1 62 THR n 1 63 GLU n 1 64 ASP n 1 65 THR n 1 66 SER n 1 67 LYS n 1 68 THR n 1 69 LEU n 1 70 GLU n 1 71 LEU n 1 72 LYS n 1 73 ALA n 1 74 GLU n 1 75 GLY n 1 76 VAL n 1 77 THR n 1 78 VAL n 1 79 GLN n 1 80 PRO n 1 81 SER n 1 82 THR n 1 83 VAL n 1 84 LYS n 1 85 VAL n 1 86 ASN n 1 87 LEU n 1 88 LYS n 1 89 VAL n 1 90 THR n 1 91 GLN n 1 92 LYS n 1 93 LEU n 1 94 GLU n 1 95 HIS n 1 96 HIS n 1 97 HIS n 1 98 HIS n 1 99 HIS n 1 100 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene stu1252 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC BAA-250 / LMG 18311' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptococcus thermophilus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 264199 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'pET 21-23C' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q5M3V7_STRT2 _struct_ref.pdbx_db_accession Q5M3V7 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KISLRKLSKSVPVKLELTGDKASNVSSISYSFDRGHVTIVGSQEAMDKIDSITVPVDISQVTEDTSKTLELKAEGVTVQP STVKVNLKVTQK ; _struct_ref.pdbx_align_begin 230 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KXY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 92 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5M3V7 _struct_ref_seq.db_align_beg 230 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 321 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 92 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KXY LEU A 93 ? UNP Q5M3V7 ? ? 'expression tag' 93 1 1 2KXY GLU A 94 ? UNP Q5M3V7 ? ? 'expression tag' 94 2 1 2KXY HIS A 95 ? UNP Q5M3V7 ? ? 'expression tag' 95 3 1 2KXY HIS A 96 ? UNP Q5M3V7 ? ? 'expression tag' 96 4 1 2KXY HIS A 97 ? UNP Q5M3V7 ? ? 'expression tag' 97 5 1 2KXY HIS A 98 ? UNP Q5M3V7 ? ? 'expression tag' 98 6 1 2KXY HIS A 99 ? UNP Q5M3V7 ? ? 'expression tag' 99 7 1 2KXY HIS A 100 ? UNP Q5M3V7 ? ? 'expression tag' 100 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCACB' 1 5 1 '3D HNCO' 1 6 1 '3D HBHA(CO)NH' 1 7 1 '3D HCCH-TOCSY' 1 8 1 '3D 1H-15N NOESY' 1 9 1 '3D 1H-13C NOESY' 1 10 1 '2D J-mod NH' 1 11 1 '2D J-mod NCO' 1 12 1 '2D J-mod NH' 1 13 1 '2D J-mod NCO' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.3 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents ;0.935 mM [U-99% 13C; U-99% 15N] protein sur18c-1, 20 mM MES-2, 200 mM sodium chloride-3, 5 mM calcium chloride-4, 100 mM DTT-5, 3 mM sodium azide-6, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2KXY _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 60 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KXY _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KXY _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal Varian collection VnmrJ ? 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 2 Goddard 'chemical shift assignment' Sparky ? 3 Goddard 'peak picking' Sparky ? 4 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 5 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KXY _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KXY _struct.title 'Solution structure of SuR18C from Streptococcus thermophilus. Northeast Structural Genomics Consortium Target SuR18C' _struct.pdbx_model_details 'lowest energy, model 2' _struct.pdbx_CASP_flag Y _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KXY _struct_keywords.pdbx_keywords 'Structural Genomics, Unknown function' _struct_keywords.text ;beta strand protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Unknown function ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 42 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ILE _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 49 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 42 _struct_conf.end_auth_comp_id ILE _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 49 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLN 79 A . ? GLN 79 A PRO 80 A ? PRO 80 A 1 -0.64 2 GLN 79 A . ? GLN 79 A PRO 80 A ? PRO 80 A 2 0.54 3 GLN 79 A . ? GLN 79 A PRO 80 A ? PRO 80 A 3 0.24 4 GLN 79 A . ? GLN 79 A PRO 80 A ? PRO 80 A 4 0.31 5 GLN 79 A . ? GLN 79 A PRO 80 A ? PRO 80 A 5 0.20 6 GLN 79 A . ? GLN 79 A PRO 80 A ? PRO 80 A 6 0.20 7 GLN 79 A . ? GLN 79 A PRO 80 A ? PRO 80 A 7 -0.94 8 GLN 79 A . ? GLN 79 A PRO 80 A ? PRO 80 A 8 0.59 9 GLN 79 A . ? GLN 79 A PRO 80 A ? PRO 80 A 9 0.05 10 GLN 79 A . ? GLN 79 A PRO 80 A ? PRO 80 A 10 0.06 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? C ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 8 ? SER A 10 ? SER A 8 SER A 10 A 2 THR A 38 ? GLY A 41 ? THR A 38 GLY A 41 A 3 VAL A 76 ? GLN A 79 ? VAL A 76 GLN A 79 B 1 VAL A 13 ? THR A 18 ? VAL A 13 THR A 18 B 2 ILE A 52 ? ASP A 57 ? ILE A 52 ASP A 57 C 1 VAL A 25 ? PHE A 32 ? VAL A 25 PHE A 32 C 2 THR A 82 ? GLN A 91 ? THR A 82 GLN A 91 C 3 THR A 65 ? GLU A 70 ? THR A 65 GLU A 70 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 9 ? N LYS A 9 O ILE A 39 ? O ILE A 39 A 2 3 N VAL A 40 ? N VAL A 40 O THR A 77 ? O THR A 77 B 1 2 N LYS A 14 ? N LYS A 14 O ILE A 52 ? O ILE A 52 C 1 2 N SER A 29 ? N SER A 29 O LYS A 88 ? O LYS A 88 C 2 3 O LEU A 87 ? O LEU A 87 N THR A 65 ? N THR A 65 # _atom_sites.entry_id 2KXY _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 HIS 36 36 36 HIS HIS A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 HIS 95 95 95 HIS HIS A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 HIS 97 97 97 HIS HIS A . n A 1 98 HIS 98 98 98 HIS HIS A . n A 1 99 HIS 99 99 99 HIS HIS A . n A 1 100 HIS 100 100 100 HIS HIS A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-07-14 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-05 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Experimental preparation' 6 3 'Structure model' Other 7 4 'Structure model' 'Database references' 8 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_sample_details 4 3 'Structure model' pdbx_nmr_software 5 3 'Structure model' pdbx_struct_assembly 6 3 'Structure model' pdbx_struct_oper_list 7 3 'Structure model' struct_ref_seq_dif 8 4 'Structure model' database_2 9 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_sample_details.contents' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' 5 4 'Structure model' '_database_2.pdbx_DOI' 6 4 'Structure model' '_database_2.pdbx_database_accession' 7 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'protein sur18c-1' 0.935 ? mM '[U-99% 13C; U-99% 15N]' 1 MES-2 20 ? mM ? 1 'sodium chloride-3' 200 ? mM ? 1 'calcium chloride-4' 5 ? mM ? 1 DTT-5 100 ? mM ? 1 'sodium azide-6' 3 ? mM ? 1 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 4 _pdbx_validate_close_contact.auth_atom_id_1 HZ2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 LYS _pdbx_validate_close_contact.auth_seq_id_1 9 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HE22 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 GLN _pdbx_validate_close_contact.auth_seq_id_2 43 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.32 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 2 ? ? 55.76 95.67 2 1 ARG A 34 ? ? -133.60 -49.77 3 2 SER A 3 ? ? 55.05 89.95 4 2 LEU A 4 ? ? 56.48 103.64 5 2 ARG A 5 ? ? -65.11 74.54 6 2 ARG A 34 ? ? -135.91 -51.27 7 2 SER A 81 ? ? 67.60 -6.87 8 2 GLU A 94 ? ? 50.67 -166.36 9 2 HIS A 95 ? ? 51.84 -87.55 10 2 HIS A 99 ? ? 53.85 92.14 11 3 SER A 3 ? ? -162.72 -28.71 12 3 ARG A 5 ? ? 53.46 -87.11 13 3 ARG A 34 ? ? -150.27 -38.96 14 3 GLU A 94 ? ? -170.05 149.89 15 3 HIS A 96 ? ? -169.14 89.67 16 4 SER A 3 ? ? -158.78 -63.68 17 4 LEU A 4 ? ? 59.17 -134.45 18 4 ARG A 34 ? ? -126.43 -56.79 19 4 HIS A 99 ? ? -161.19 4.55 20 5 ARG A 5 ? ? -162.36 42.13 21 5 ARG A 34 ? ? -126.61 -54.71 22 5 SER A 81 ? ? 66.99 -3.51 23 5 HIS A 95 ? ? 52.84 -178.03 24 5 HIS A 96 ? ? 51.57 83.87 25 5 HIS A 97 ? ? -167.72 83.30 26 6 LEU A 4 ? ? 60.16 145.44 27 6 SER A 81 ? ? 58.22 19.36 28 6 GLU A 94 ? ? 52.42 89.33 29 6 HIS A 96 ? ? -67.75 95.66 30 6 HIS A 97 ? ? -168.92 115.24 31 6 HIS A 98 ? ? -169.86 -21.29 32 7 ARG A 5 ? ? -63.06 -84.52 33 7 ARG A 34 ? ? -135.43 -52.38 34 7 LEU A 93 ? ? -166.03 65.42 35 7 HIS A 96 ? ? -169.04 81.27 36 8 ARG A 5 ? ? 54.22 77.68 37 8 ARG A 34 ? ? -128.13 -55.95 38 8 SER A 51 ? ? -174.13 132.74 39 8 SER A 81 ? ? 59.94 17.85 40 8 HIS A 95 ? ? 53.03 79.83 41 8 HIS A 97 ? ? -169.44 119.89 42 9 ARG A 34 ? ? -158.98 89.07 43 9 HIS A 98 ? ? -168.62 88.41 44 9 HIS A 99 ? ? 53.54 -174.96 45 10 SER A 3 ? ? 61.59 148.82 46 10 ARG A 5 ? ? -170.00 145.21 47 10 ARG A 34 ? ? -134.13 -52.09 48 10 LEU A 93 ? ? -153.16 47.97 49 10 HIS A 97 ? ? 56.92 106.12 #