data_2L09 # _entry.id 2L09 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2L09 pdb_00002l09 10.2210/pdb2l09/pdb RCSB RCSB101793 ? ? WWPDB D_1000101793 ? ? BMRB 17035 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type TargetDB Nsr143 . unspecified BMRB 17035 . unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L09 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-06-30 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Feldmann, E.A.' 1 'Yang, Y.A.' 2 'Ramelot, T.A.' 3 'Cort, J.R.' 4 'Janjua, H.' 5 'Ciccosanti, C.A.' 6 'Lee, D.' 7 'Acton, T.B.' 8 'Xiao, R.A.' 9 'Everett, J.K.' 10 'Montelione, G.T.' 11 'Kennedy, M.A.' 12 'Northeast Structural Genomics Consortium (NESG)' 13 # _citation.id primary _citation.title 'NMR Solution Structure of asr4154 from Nostoc sp. PCC7120 Northeast Structural Genomics target ID Nsr143' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Feldmann, E.A.' 1 ? primary 'Yang, Y.A.' 2 ? primary 'Ramelot, T.A.' 3 ? primary 'Cort, J.R.' 4 ? primary 'Janjua, H.' 5 ? primary 'Ciccosanti, C.A.' 6 ? primary 'Lee, D.' 7 ? primary 'Acton, T.B.' 8 ? primary 'Xiao, R.A.' 9 ? primary 'Everett, J.K.' 10 ? primary 'Montelione, G.T.' 11 ? primary 'Kennedy, M.A.' 12 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Asr4154 protein' _entity.formula_weight 7367.347 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'sequence database residues 9-61' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MNLRWTSEAKTKLKNIPFFARSQAKARIEQLARQAEQDIVTPELVEQARLEFGQLEHHHHHH _entity_poly.pdbx_seq_one_letter_code_can MNLRWTSEAKTKLKNIPFFARSQAKARIEQLARQAEQDIVTPELVEQARLEFGQLEHHHHHH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier Nsr143 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 LEU n 1 4 ARG n 1 5 TRP n 1 6 THR n 1 7 SER n 1 8 GLU n 1 9 ALA n 1 10 LYS n 1 11 THR n 1 12 LYS n 1 13 LEU n 1 14 LYS n 1 15 ASN n 1 16 ILE n 1 17 PRO n 1 18 PHE n 1 19 PHE n 1 20 ALA n 1 21 ARG n 1 22 SER n 1 23 GLN n 1 24 ALA n 1 25 LYS n 1 26 ALA n 1 27 ARG n 1 28 ILE n 1 29 GLU n 1 30 GLN n 1 31 LEU n 1 32 ALA n 1 33 ARG n 1 34 GLN n 1 35 ALA n 1 36 GLU n 1 37 GLN n 1 38 ASP n 1 39 ILE n 1 40 VAL n 1 41 THR n 1 42 PRO n 1 43 GLU n 1 44 LEU n 1 45 VAL n 1 46 GLU n 1 47 GLN n 1 48 ALA n 1 49 ARG n 1 50 LEU n 1 51 GLU n 1 52 PHE n 1 53 GLY n 1 54 GLN n 1 55 LEU n 1 56 GLU n 1 57 HIS n 1 58 HIS n 1 59 HIS n 1 60 HIS n 1 61 HIS n 1 62 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene asr4154 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'PCC 7120' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Nostoc sp.' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 103690 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3) pMGK' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'pET 21-23C' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8YPN9_ANASP _struct_ref.pdbx_db_accession Q8YPN9 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code NLRWTSEAKTKLKNIPFFARSQAKARIEQLARQAEQDIVTPELVEQARLEFGQ _struct_ref.pdbx_align_begin 9 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2L09 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 54 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8YPN9 _struct_ref_seq.db_align_beg 9 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 61 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 54 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2L09 MET A 1 ? UNP Q8YPN9 ? ? 'initiating methionine' 1 1 1 2L09 LEU A 55 ? UNP Q8YPN9 ? ? 'expression tag' 55 2 1 2L09 GLU A 56 ? UNP Q8YPN9 ? ? 'expression tag' 56 3 1 2L09 HIS A 57 ? UNP Q8YPN9 ? ? 'expression tag' 57 4 1 2L09 HIS A 58 ? UNP Q8YPN9 ? ? 'expression tag' 58 5 1 2L09 HIS A 59 ? UNP Q8YPN9 ? ? 'expression tag' 59 6 1 2L09 HIS A 60 ? UNP Q8YPN9 ? ? 'expression tag' 60 7 1 2L09 HIS A 61 ? UNP Q8YPN9 ? ? 'expression tag' 61 8 1 2L09 HIS A 62 ? UNP Q8YPN9 ? ? 'expression tag' 62 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HSQC_CT' 1 3 1 '3D 1H-15N NOESY' 1 4 1 '3D 1H-13C NOESY' 1 5 1 '3D HNCO' 1 6 1 '3D HNCA' 1 7 1 '3D HNCACB' 1 8 1 '3D CBCA(CO)NH' 1 9 1 '3D HN(CO)CA' 1 10 1 '3D HBHA(CO)NH' 1 11 1 '3D H(CCO)NH' 1 12 1 '3D C(CO)NH' 1 13 1 '3D HCCH-TOCSY' 1 14 1 '3D HCCH-COSY' 1 15 3 '3D HCCH-TOCSY' 1 16 3 '4D CC NOESY' 1 17 1 '2D 1H-15N HSQC_swN150ppm' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.2 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.9 mM [U-100% 13C; U-100% 15N] Hypothetical protein asr4154 from Nostoc sp. PCC7120, 20 mM MES, 100 mM sodium chloride, 5 mM calcium chloride, 10 mM DTT, 0.02 % sodium azide, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;0.82 mM [U-5% 13C; U-100% 15N] Hypothetical protein asr4154 from Nostoc sp. PCC7120, 20 mM MES, 100 mM sodium chloride, 5 mM calcium chloride, 10 mM DTT, 0.02 % sodium azide, 90% H2O/10% D2O ; 2 '90% H2O/10% D2O' ;0.9 mM [U-100% 13C; U-100% 15N] Hypothetical protein asr4154 from Nostoc sp. PCC7120, 20 mM MES, 100 mM sodium chloride, 5 mM calcium chloride, 10 mM DTT, 0.02 % sodium azide, 100% D2O ; 3 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 850 Bruker 'AVANCE III' 2 'Bruker AvanceIII' 500 Varian INOVA 3 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2L09 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'CNS water' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 125 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L09 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L09 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 2008 1 Varian collection VNMR 6.1C 2 'Bruker Biospin' collection TopSpin 2.1.4 3 'Huang, Tejero, Powers and Montelione' 'data analysis' AutoStructure 2.2.1 4 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' 2.20 5 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.2 6 Goddard 'data analysis' Sparky 3.113 7 'Bhattacharya and Montelione' refinement PSVS 1.4 8 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.30 9 '(PdbStat)-Roberto Tejero and Gaetano T. Montelione' 'structure solution' PdbStat 5.1 10 'Bahrami, A., Assadi, A., Markley, J. L. & Eghbalnia, H.' autoassignment 'PINE Server' 1.0 11 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 12 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'Hypothetical protein' _exptl.entry_id 2L09 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L09 _struct.title 'Solution NMR Structure of Protein asr4154 from Nostoc sp. PCC7120 Northeast Structural Genomics Consortium target ID NsR143' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag Y _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L09 _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text ;proto-chlorophyllide reductase 57 kD subunit superfamily, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, OXIDOREDUCTASE ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 6 ? ASN A 15 ? THR A 6 ASN A 15 1 ? 10 HELX_P HELX_P2 2 PRO A 17 ? PHE A 19 ? PRO A 17 PHE A 19 5 ? 3 HELX_P HELX_P3 3 ALA A 20 ? ALA A 35 ? ALA A 20 ALA A 35 1 ? 16 HELX_P HELX_P4 4 THR A 41 ? GLU A 56 ? THR A 41 GLU A 56 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 4 ? TRP A 5 ? ARG A 4 TRP A 5 A 2 ILE A 39 ? VAL A 40 ? ILE A 39 VAL A 40 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ARG _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 4 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ARG _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 4 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 40 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 40 # _atom_sites.entry_id 2L09 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 TRP 5 5 5 TRP TRP A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 HIS 59 59 59 HIS HIS A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 HIS 62 62 62 HIS HIS A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-08-25 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-05 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Source and taxonomy' 2 2 'Structure model' 'Version format compliance' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' Other 6 4 'Structure model' 'Database references' 7 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' struct_ref_seq_dif 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 3 'Structure model' '_struct_ref_seq_dif.details' 5 4 'Structure model' '_database_2.pdbx_DOI' 6 4 'Structure model' '_database_2.pdbx_database_accession' 7 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'Hypothetical protein asr4154 from Nostoc sp. PCC7120-1' 0.9 ? mM '[U-100% 13C; U-100% 15N]' 1 MES-2 20 ? mM ? 1 'sodium chloride-3' 100 ? mM ? 1 'calcium chloride-4' 5 ? mM ? 1 DTT-5 10 ? mM ? 1 'sodium azide-6' 0.02 ? % ? 1 'Hypothetical protein asr4154 from Nostoc sp. PCC7120-7' 0.82 ? mM '[U-5% 13C; U-100% 15N]' 2 MES-8 20 ? mM ? 2 'sodium chloride-9' 100 ? mM ? 2 'calcium chloride-10' 5 ? mM ? 2 DTT-11 10 ? mM ? 2 'sodium azide-12' 0.02 ? % ? 2 'Hypothetical protein asr4154 from Nostoc sp. PCC7120-13' 0.9 ? mM '[U-100% 13C; U-100% 15N]' 3 MES-14 20 ? mM ? 3 'sodium chloride-15' 100 ? mM ? 3 'calcium chloride-16' 5 ? mM ? 3 DTT-17 10 ? mM ? 3 'sodium azide-18' 0.02 ? % ? 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 7 HG1 A THR 41 ? ? OE1 A GLU 43 ? ? 1.59 2 9 OE2 A GLU 56 ? ? HD1 A HIS 57 ? ? 1.60 3 14 HG3 A GLU 56 ? ? H A HIS 57 ? ? 1.34 4 17 HZ3 A LYS 25 ? ? OE2 A GLU 29 ? ? 1.56 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 58 ? ? 71.42 -71.34 2 2 GLU A 56 ? ? -79.05 -72.62 3 2 HIS A 59 ? ? -53.88 107.71 4 2 HIS A 60 ? ? -113.20 79.96 5 3 GLU A 36 ? ? 70.45 43.44 6 3 GLU A 56 ? ? 65.57 62.29 7 3 HIS A 57 ? ? 71.52 -56.20 8 3 HIS A 59 ? ? -43.65 103.04 9 3 HIS A 60 ? ? -78.74 -75.40 10 4 HIS A 59 ? ? -140.87 -78.16 11 4 HIS A 60 ? ? -142.25 24.82 12 4 HIS A 61 ? ? 64.02 -159.82 13 5 LEU A 55 ? ? -76.27 -72.09 14 5 GLU A 56 ? ? 53.55 -145.56 15 6 GLU A 56 ? ? -69.15 86.23 16 6 HIS A 58 ? ? 61.33 -100.35 17 6 HIS A 59 ? ? 65.20 -66.91 18 8 GLU A 56 ? ? 68.59 117.82 19 8 HIS A 58 ? ? 75.33 -46.42 20 8 HIS A 60 ? ? -149.14 53.84 21 8 HIS A 61 ? ? -165.46 -51.39 22 9 GLU A 56 ? ? 62.50 81.20 23 9 HIS A 57 ? ? 66.77 177.96 24 9 HIS A 58 ? ? -158.38 84.12 25 9 HIS A 59 ? ? -166.10 -30.92 26 9 HIS A 61 ? ? 70.11 154.67 27 10 HIS A 57 ? ? 68.55 98.26 28 10 HIS A 58 ? ? 73.80 -72.94 29 11 ASN A 2 ? ? 70.20 138.59 30 11 HIS A 57 ? ? -98.82 -67.05 31 12 ASN A 2 ? ? 60.46 95.02 32 12 LEU A 55 ? ? -74.40 -87.73 33 13 GLU A 56 ? ? 55.84 -103.03 34 13 HIS A 57 ? ? -148.83 -53.37 35 14 ASN A 2 ? ? 64.39 156.04 36 14 GLU A 56 ? ? 38.90 -88.28 37 14 HIS A 61 ? ? 63.77 -170.07 38 15 GLU A 56 ? ? 65.32 -67.96 39 15 HIS A 59 ? ? -66.35 -70.16 40 15 HIS A 61 ? ? 69.04 -66.01 41 16 LEU A 55 ? ? -76.89 -96.94 42 16 GLU A 56 ? ? 44.18 -91.32 43 16 HIS A 58 ? ? -88.61 35.59 44 16 HIS A 59 ? ? -130.83 -50.79 45 17 ASN A 2 ? ? 66.79 99.13 46 17 GLU A 56 ? ? -126.75 -78.75 47 18 ASN A 2 ? ? 62.72 71.31 48 18 GLU A 56 ? ? 56.51 80.74 49 18 HIS A 61 ? ? 53.31 74.17 50 19 ASN A 2 ? ? 65.30 83.97 51 19 LEU A 55 ? ? -86.66 -94.88 52 19 GLU A 56 ? ? 57.36 12.35 53 20 HIS A 60 ? ? 69.05 161.46 #