data_2L2A # _entry.id 2L2A # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2L2A RCSB RCSB101866 WWPDB D_1000101866 # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 2CNJ PDB 'NMR STUDIES ON THE INTERACTION OF INSULIN-GROWTH FACTOR II (IGF-II) WITH IGF2R DOMAIN 11' unspecified 1GP0 PDB 'HUMAN IGF2R DOMAIN 11' unspecified 2L21 PDB 'Chicken IGF2R domain 11' unspecified 2L29 PDB 'Complex structure of E4 mutant human IGF2R domain 11 bound to IGF-II' unspecified 17128 BMRB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L2A _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-08-13 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Williams, C.' 1 'Hoppe, H.' 2 'Rezgui, D.' 3 'Strickland, M.' 4 'Frago, S.' 5 'Ellis, R.Z.' 6 'Wattana-Amorn, P.' 7 'Prince, S.N.' 8 'Zaccheo, O.J.' 9 'Forbes, B.' 10 'Jones, E.Y.' 11 'Crump, M.P.' 12 'Hassan, A.B.' 13 # _citation.id primary _citation.title 'An exon splice enhancer primes IGF2:IGF2R binding site structure and function evolution.' _citation.journal_abbrev Science _citation.journal_volume 338 _citation.page_first 1209 _citation.page_last 1213 _citation.year 2012 _citation.journal_id_ASTM SCIEAS _citation.country US _citation.journal_id_ISSN 0036-8075 _citation.journal_id_CSD 0038 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23197533 _citation.pdbx_database_id_DOI 10.1126/science.1228633 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Williams, C.' 1 primary 'Hoppe, H.J.' 2 primary 'Rezgui, D.' 3 primary 'Strickland, M.' 4 primary 'Forbes, B.E.' 5 primary 'Grutzner, F.' 6 primary 'Frago, S.' 7 primary 'Ellis, R.Z.' 8 primary 'Wattana-Amorn, P.' 9 primary 'Prince, S.N.' 10 primary 'Zaccheo, O.J.' 11 primary 'Nolan, C.M.' 12 primary 'Mungall, A.J.' 13 primary 'Jones, E.Y.' 14 primary 'Crump, M.P.' 15 primary 'Hassan, A.B.' 16 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Insulin-like growth factor 2 receptor variant' _entity.formula_weight 15434.524 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'E1544K, K1545S, L1547V' _entity.pdbx_fragment 'domain 11, residues 1431-1570' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYSKSGVVYMSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQV LQLVYKDGSPCPSKSGLSYKSVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACEPE ; _entity_poly.pdbx_seq_one_letter_code_can ;MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYSKSGVVYMSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQV LQLVYKDGSPCPSKSGLSYKSVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACEPE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 SER n 1 4 ASN n 1 5 GLU n 1 6 HIS n 1 7 ASP n 1 8 ASP n 1 9 CYS n 1 10 GLN n 1 11 VAL n 1 12 THR n 1 13 ASN n 1 14 PRO n 1 15 SER n 1 16 THR n 1 17 GLY n 1 18 HIS n 1 19 LEU n 1 20 PHE n 1 21 ASP n 1 22 LEU n 1 23 SER n 1 24 SER n 1 25 LEU n 1 26 SER n 1 27 GLY n 1 28 ARG n 1 29 ALA n 1 30 GLY n 1 31 PHE n 1 32 THR n 1 33 ALA n 1 34 ALA n 1 35 TYR n 1 36 SER n 1 37 LYS n 1 38 SER n 1 39 GLY n 1 40 VAL n 1 41 VAL n 1 42 TYR n 1 43 MET n 1 44 SER n 1 45 ILE n 1 46 CYS n 1 47 GLY n 1 48 GLU n 1 49 ASN n 1 50 GLU n 1 51 ASN n 1 52 CYS n 1 53 PRO n 1 54 PRO n 1 55 GLY n 1 56 VAL n 1 57 GLY n 1 58 ALA n 1 59 CYS n 1 60 PHE n 1 61 GLY n 1 62 GLN n 1 63 THR n 1 64 ARG n 1 65 ILE n 1 66 SER n 1 67 VAL n 1 68 GLY n 1 69 LYS n 1 70 ALA n 1 71 ASN n 1 72 LYS n 1 73 ARG n 1 74 LEU n 1 75 ARG n 1 76 TYR n 1 77 VAL n 1 78 ASP n 1 79 GLN n 1 80 VAL n 1 81 LEU n 1 82 GLN n 1 83 LEU n 1 84 VAL n 1 85 TYR n 1 86 LYS n 1 87 ASP n 1 88 GLY n 1 89 SER n 1 90 PRO n 1 91 CYS n 1 92 PRO n 1 93 SER n 1 94 LYS n 1 95 SER n 1 96 GLY n 1 97 LEU n 1 98 SER n 1 99 TYR n 1 100 LYS n 1 101 SER n 1 102 VAL n 1 103 ILE n 1 104 SER n 1 105 PHE n 1 106 VAL n 1 107 CYS n 1 108 ARG n 1 109 PRO n 1 110 GLU n 1 111 ALA n 1 112 GLY n 1 113 PRO n 1 114 THR n 1 115 ASN n 1 116 ARG n 1 117 PRO n 1 118 MET n 1 119 LEU n 1 120 ILE n 1 121 SER n 1 122 LEU n 1 123 ASP n 1 124 LYS n 1 125 GLN n 1 126 THR n 1 127 CYS n 1 128 THR n 1 129 LEU n 1 130 PHE n 1 131 PHE n 1 132 SER n 1 133 TRP n 1 134 HIS n 1 135 THR n 1 136 PRO n 1 137 LEU n 1 138 ALA n 1 139 CYS n 1 140 GLU n 1 141 PRO n 1 142 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene igf2r _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET26a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q59EZ3_HUMAN _struct_ref.pdbx_db_accession Q59EZ3 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYSEKGLVYMSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQV LQLVYKDGSPCPSKSGLSYKSVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACE ; _struct_ref.pdbx_align_begin 1431 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2L2A _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 140 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q59EZ3 _struct_ref_seq.db_align_beg 1431 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1570 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1508 _struct_ref_seq.pdbx_auth_seq_align_end 1647 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2L2A LYS A 37 ? UNP Q59EZ3 GLU 1467 'ENGINEERED MUTATION' 1544 1 1 2L2A SER A 38 ? UNP Q59EZ3 LYS 1468 'ENGINEERED MUTATION' 1545 2 1 2L2A VAL A 40 ? UNP Q59EZ3 LEU 1470 'ENGINEERED MUTATION' 1547 3 1 2L2A PRO A 141 ? UNP Q59EZ3 ? ? 'EXPRESSION TAG' 1648 4 1 2L2A GLU A 142 ? UNP Q59EZ3 ? ? 'EXPRESSION TAG' 1649 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D C(CO)NH' 1 6 1 '3D HNCO' 1 7 1 '3D HNCA' 1 8 1 '3D HNCACB' 1 9 1 '3D HN(CO)CA' 1 10 1 '3D 1H-15N NOESY' 1 11 1 '3D 1H-13C NOESY' 1 12 1 '3D HCCH-TOCSY' 1 13 1 '3D H(CCO)NH' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pH 4.2 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '5% D2O, 10 mM [U-99% 2H] sodium acetate, 0.5-1 mM [U-98% 13C; U-98% 15N] IGF2R, 100 uM EDTA, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model VNMRS _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian VNMRS' # _pdbx_nmr_refine.entry_id 2L2A _pdbx_nmr_refine.method 'simulated annealing, simulated annealing' _pdbx_nmr_refine.details ;ARIA2.2 protocol. Cool_1 and cool_2 steps increased to 40K and cool_2, ARIA2.2 water refinement modified with RECOORD water refinement parameters ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L2A _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L2A _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal Varian collection VNMRJ ? 1 CCPN 'chemical shift assignment' Analysis 2.13 2 CCPN 'data analysis' Analysis 2.13 3 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 4 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS ? 5 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 6 'Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS ? 7 'Vuister, Doreleijers, Sousa da Silva' refinement iCing r765 8 ;Linge, O'Donoghue and Nilges ; refinement ARIA 2.2 9 ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA 2.2 10 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'E4 IGF2R domain 11' _exptl.entry_id 2L2A _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L2A _struct.title 'Mutated Domain 11 of the Cytoplasmic region of the Cation-independent mannose-6-phosphate receptor' _struct.pdbx_descriptor 'Insulin-like growth factor 2 receptor variant' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L2A _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' _struct_keywords.text 'mannose 6 phosphate receptor, protein evolution, Insulin-like growth factor 2, Genomic imprinting, TRANSPORT PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 46 SG ? ? A CYS 1516 A CYS 1553 1_555 ? ? ? ? ? ? ? 2.024 ? disulf2 disulf ? ? A CYS 52 SG ? ? ? 1_555 A CYS 59 SG ? ? A CYS 1559 A CYS 1566 1_555 ? ? ? ? ? ? ? 2.033 ? disulf3 disulf ? ? A CYS 91 SG ? ? ? 1_555 A CYS 127 SG ? ? A CYS 1598 A CYS 1634 1_555 ? ? ? ? ? ? ? 2.011 ? disulf4 disulf ? ? A CYS 107 SG ? ? ? 1_555 A CYS 139 SG ? ? A CYS 1614 A CYS 1646 1_555 ? ? ? ? ? ? ? 2.025 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 4 ? C ? 5 ? D ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel C 3 4 ? parallel C 4 5 ? anti-parallel D 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 10 ? THR A 12 ? GLN A 1517 THR A 1519 A 2 LEU A 19 ? ASP A 21 ? LEU A 1526 ASP A 1528 B 1 PHE A 31 ? ALA A 33 ? PHE A 1538 ALA A 1540 B 2 VAL A 41 ? MET A 43 ? VAL A 1548 MET A 1550 B 3 ALA A 58 ? PHE A 60 ? ALA A 1565 PHE A 1567 B 4 ILE A 65 ? SER A 66 ? ILE A 1572 SER A 1573 C 1 LEU A 74 ? VAL A 77 ? LEU A 1581 VAL A 1584 C 2 VAL A 80 ? TYR A 85 ? VAL A 1587 TYR A 1592 C 3 LYS A 100 ? VAL A 106 ? LYS A 1607 VAL A 1613 C 4 THR A 128 ? HIS A 134 ? THR A 1635 HIS A 1641 C 5 MET A 118 ? ASP A 123 ? MET A 1625 ASP A 1630 D 1 PRO A 90 ? CYS A 91 ? PRO A 1597 CYS A 1598 D 2 LEU A 97 ? SER A 98 ? LEU A 1604 SER A 1605 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 11 ? N VAL A 1518 O PHE A 20 ? O PHE A 1527 B 1 2 N PHE A 31 ? N PHE A 1538 O MET A 43 ? O MET A 1550 B 2 3 N TYR A 42 ? N TYR A 1549 O CYS A 59 ? O CYS A 1566 B 3 4 N PHE A 60 ? N PHE A 1567 O ILE A 65 ? O ILE A 1572 C 1 2 N ARG A 75 ? N ARG A 1582 O GLN A 82 ? O GLN A 1589 C 2 3 N TYR A 85 ? N TYR A 1592 O SER A 101 ? O SER A 1608 C 3 4 N VAL A 102 ? N VAL A 1609 O PHE A 131 ? O PHE A 1638 C 4 5 O THR A 128 ? O THR A 1635 N ASP A 123 ? N ASP A 1630 D 1 2 N CYS A 91 ? N CYS A 1598 O LEU A 97 ? O LEU A 1604 # _atom_sites.entry_id 2L2A _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1508 1508 MET MET A . n A 1 2 LYS 2 1509 1509 LYS LYS A . n A 1 3 SER 3 1510 1510 SER SER A . n A 1 4 ASN 4 1511 1511 ASN ASN A . n A 1 5 GLU 5 1512 1512 GLU GLU A . n A 1 6 HIS 6 1513 1513 HIS HIS A . n A 1 7 ASP 7 1514 1514 ASP ASP A . n A 1 8 ASP 8 1515 1515 ASP ASP A . n A 1 9 CYS 9 1516 1516 CYS CYS A . n A 1 10 GLN 10 1517 1517 GLN GLN A . n A 1 11 VAL 11 1518 1518 VAL VAL A . n A 1 12 THR 12 1519 1519 THR THR A . n A 1 13 ASN 13 1520 1520 ASN ASN A . n A 1 14 PRO 14 1521 1521 PRO PRO A . n A 1 15 SER 15 1522 1522 SER SER A . n A 1 16 THR 16 1523 1523 THR THR A . n A 1 17 GLY 17 1524 1524 GLY GLY A . n A 1 18 HIS 18 1525 1525 HIS HIS A . n A 1 19 LEU 19 1526 1526 LEU LEU A . n A 1 20 PHE 20 1527 1527 PHE PHE A . n A 1 21 ASP 21 1528 1528 ASP ASP A . n A 1 22 LEU 22 1529 1529 LEU LEU A . n A 1 23 SER 23 1530 1530 SER SER A . n A 1 24 SER 24 1531 1531 SER SER A . n A 1 25 LEU 25 1532 1532 LEU LEU A . n A 1 26 SER 26 1533 1533 SER SER A . n A 1 27 GLY 27 1534 1534 GLY GLY A . n A 1 28 ARG 28 1535 1535 ARG ARG A . n A 1 29 ALA 29 1536 1536 ALA ALA A . n A 1 30 GLY 30 1537 1537 GLY GLY A . n A 1 31 PHE 31 1538 1538 PHE PHE A . n A 1 32 THR 32 1539 1539 THR THR A . n A 1 33 ALA 33 1540 1540 ALA ALA A . n A 1 34 ALA 34 1541 1541 ALA ALA A . n A 1 35 TYR 35 1542 1542 TYR TYR A . n A 1 36 SER 36 1543 1543 SER SER A . n A 1 37 LYS 37 1544 1544 LYS LYS A . n A 1 38 SER 38 1545 1545 SER SER A . n A 1 39 GLY 39 1546 1546 GLY GLY A . n A 1 40 VAL 40 1547 1547 VAL VAL A . n A 1 41 VAL 41 1548 1548 VAL VAL A . n A 1 42 TYR 42 1549 1549 TYR TYR A . n A 1 43 MET 43 1550 1550 MET MET A . n A 1 44 SER 44 1551 1551 SER SER A . n A 1 45 ILE 45 1552 1552 ILE ILE A . n A 1 46 CYS 46 1553 1553 CYS CYS A . n A 1 47 GLY 47 1554 1554 GLY GLY A . n A 1 48 GLU 48 1555 1555 GLU GLU A . n A 1 49 ASN 49 1556 1556 ASN ASN A . n A 1 50 GLU 50 1557 1557 GLU GLU A . n A 1 51 ASN 51 1558 1558 ASN ASN A . n A 1 52 CYS 52 1559 1559 CYS CYS A . n A 1 53 PRO 53 1560 1560 PRO PRO A . n A 1 54 PRO 54 1561 1561 PRO PRO A . n A 1 55 GLY 55 1562 1562 GLY GLY A . n A 1 56 VAL 56 1563 1563 VAL VAL A . n A 1 57 GLY 57 1564 1564 GLY GLY A . n A 1 58 ALA 58 1565 1565 ALA ALA A . n A 1 59 CYS 59 1566 1566 CYS CYS A . n A 1 60 PHE 60 1567 1567 PHE PHE A . n A 1 61 GLY 61 1568 1568 GLY GLY A . n A 1 62 GLN 62 1569 1569 GLN GLN A . n A 1 63 THR 63 1570 1570 THR THR A . n A 1 64 ARG 64 1571 1571 ARG ARG A . n A 1 65 ILE 65 1572 1572 ILE ILE A . n A 1 66 SER 66 1573 1573 SER SER A . n A 1 67 VAL 67 1574 1574 VAL VAL A . n A 1 68 GLY 68 1575 1575 GLY GLY A . n A 1 69 LYS 69 1576 1576 LYS LYS A . n A 1 70 ALA 70 1577 1577 ALA ALA A . n A 1 71 ASN 71 1578 1578 ASN ASN A . n A 1 72 LYS 72 1579 1579 LYS LYS A . n A 1 73 ARG 73 1580 1580 ARG ARG A . n A 1 74 LEU 74 1581 1581 LEU LEU A . n A 1 75 ARG 75 1582 1582 ARG ARG A . n A 1 76 TYR 76 1583 1583 TYR TYR A . n A 1 77 VAL 77 1584 1584 VAL VAL A . n A 1 78 ASP 78 1585 1585 ASP ASP A . n A 1 79 GLN 79 1586 1586 GLN GLN A . n A 1 80 VAL 80 1587 1587 VAL VAL A . n A 1 81 LEU 81 1588 1588 LEU LEU A . n A 1 82 GLN 82 1589 1589 GLN GLN A . n A 1 83 LEU 83 1590 1590 LEU LEU A . n A 1 84 VAL 84 1591 1591 VAL VAL A . n A 1 85 TYR 85 1592 1592 TYR TYR A . n A 1 86 LYS 86 1593 1593 LYS LYS A . n A 1 87 ASP 87 1594 1594 ASP ASP A . n A 1 88 GLY 88 1595 1595 GLY GLY A . n A 1 89 SER 89 1596 1596 SER SER A . n A 1 90 PRO 90 1597 1597 PRO PRO A . n A 1 91 CYS 91 1598 1598 CYS CYS A . n A 1 92 PRO 92 1599 1599 PRO PRO A . n A 1 93 SER 93 1600 1600 SER SER A . n A 1 94 LYS 94 1601 1601 LYS LYS A . n A 1 95 SER 95 1602 1602 SER SER A . n A 1 96 GLY 96 1603 1603 GLY GLY A . n A 1 97 LEU 97 1604 1604 LEU LEU A . n A 1 98 SER 98 1605 1605 SER SER A . n A 1 99 TYR 99 1606 1606 TYR TYR A . n A 1 100 LYS 100 1607 1607 LYS LYS A . n A 1 101 SER 101 1608 1608 SER SER A . n A 1 102 VAL 102 1609 1609 VAL VAL A . n A 1 103 ILE 103 1610 1610 ILE ILE A . n A 1 104 SER 104 1611 1611 SER SER A . n A 1 105 PHE 105 1612 1612 PHE PHE A . n A 1 106 VAL 106 1613 1613 VAL VAL A . n A 1 107 CYS 107 1614 1614 CYS CYS A . n A 1 108 ARG 108 1615 1615 ARG ARG A . n A 1 109 PRO 109 1616 1616 PRO PRO A . n A 1 110 GLU 110 1617 1617 GLU GLU A . n A 1 111 ALA 111 1618 1618 ALA ALA A . n A 1 112 GLY 112 1619 1619 GLY GLY A . n A 1 113 PRO 113 1620 1620 PRO PRO A . n A 1 114 THR 114 1621 1621 THR THR A . n A 1 115 ASN 115 1622 1622 ASN ASN A . n A 1 116 ARG 116 1623 1623 ARG ARG A . n A 1 117 PRO 117 1624 1624 PRO PRO A . n A 1 118 MET 118 1625 1625 MET MET A . n A 1 119 LEU 119 1626 1626 LEU LEU A . n A 1 120 ILE 120 1627 1627 ILE ILE A . n A 1 121 SER 121 1628 1628 SER SER A . n A 1 122 LEU 122 1629 1629 LEU LEU A . n A 1 123 ASP 123 1630 1630 ASP ASP A . n A 1 124 LYS 124 1631 1631 LYS LYS A . n A 1 125 GLN 125 1632 1632 GLN GLN A . n A 1 126 THR 126 1633 1633 THR THR A . n A 1 127 CYS 127 1634 1634 CYS CYS A . n A 1 128 THR 128 1635 1635 THR THR A . n A 1 129 LEU 129 1636 1636 LEU LEU A . n A 1 130 PHE 130 1637 1637 PHE PHE A . n A 1 131 PHE 131 1638 1638 PHE PHE A . n A 1 132 SER 132 1639 1639 SER SER A . n A 1 133 TRP 133 1640 1640 TRP TRP A . n A 1 134 HIS 134 1641 1641 HIS HIS A . n A 1 135 THR 135 1642 1642 THR THR A . n A 1 136 PRO 136 1643 1643 PRO PRO A . n A 1 137 LEU 137 1644 1644 LEU LEU A . n A 1 138 ALA 138 1645 1645 ALA ALA A . n A 1 139 CYS 139 1646 1646 CYS CYS A . n A 1 140 GLU 140 1647 1647 GLU GLU A . n A 1 141 PRO 141 1648 1648 PRO PRO A . n A 1 142 GLU 142 1649 1649 GLU GLU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-02-15 2 'Structure model' 1 1 2012-12-12 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id D2O-1 5 ? % ? 1 'sodium acetate-2' 10 ? mM '[U-99% 2H]' 1 entity-3 ? 0.5-1 mM '[U-98% 13C; U-98% 15N]' 1 EDTA-4 100 ? uM ? 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 4 HZ1 A LYS 1593 ? ? OD1 A ASP 1594 ? ? 1.58 2 6 HG A LEU 1629 ? ? HG A LEU 1636 ? ? 1.34 3 8 HA A PRO 1620 ? ? HZ2 A TRP 1640 ? ? 1.32 4 10 HE1 A PHE 1612 ? ? HE3 A TRP 1640 ? ? 1.26 5 10 HD21 A ASN 1520 ? ? HH A TYR 1583 ? ? 1.27 6 10 OD2 A ASP 1528 ? ? HG A SER 1531 ? ? 1.58 7 15 HG A LEU 1629 ? ? HG A LEU 1636 ? ? 1.32 8 16 OD2 A ASP 1630 ? ? HG1 A THR 1633 ? ? 1.56 9 17 HA A VAL 1574 ? ? HB3 A SER 1596 ? ? 1.32 10 18 HG A LEU 1629 ? ? HG A LEU 1636 ? ? 1.33 11 20 HZ2 A LYS 1593 ? ? OD2 A ASP 1594 ? ? 1.59 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 2 CE1 A TYR 1592 ? ? CZ A TYR 1592 ? ? 1.272 1.381 -0.109 0.013 N 2 2 CZ A TYR 1592 ? ? CE2 A TYR 1592 ? ? 1.476 1.381 0.095 0.013 N 3 3 CE1 A TYR 1549 ? ? CZ A TYR 1549 ? ? 1.289 1.381 -0.092 0.013 N 4 3 CZ A TYR 1549 ? ? CE2 A TYR 1549 ? ? 1.476 1.381 0.095 0.013 N 5 3 CE1 A TYR 1592 ? ? CZ A TYR 1592 ? ? 1.296 1.381 -0.085 0.013 N 6 5 CE1 A TYR 1549 ? ? CZ A TYR 1549 ? ? 1.486 1.381 0.105 0.013 N 7 5 CZ A TYR 1549 ? ? CE2 A TYR 1549 ? ? 1.264 1.381 -0.117 0.013 N 8 12 CE1 A TYR 1606 ? ? CZ A TYR 1606 ? ? 1.288 1.381 -0.093 0.013 N 9 12 CZ A TYR 1606 ? ? CE2 A TYR 1606 ? ? 1.468 1.381 0.087 0.013 N 10 15 CE1 A TYR 1583 ? ? CZ A TYR 1583 ? ? 1.289 1.381 -0.092 0.013 N 11 15 CZ A TYR 1583 ? ? CE2 A TYR 1583 ? ? 1.463 1.381 0.082 0.013 N 12 16 CE1 A TYR 1606 ? ? CZ A TYR 1606 ? ? 1.497 1.381 0.116 0.013 N 13 16 CZ A TYR 1606 ? ? CE2 A TYR 1606 ? ? 1.268 1.381 -0.113 0.013 N 14 18 CE1 A TYR 1592 ? ? CZ A TYR 1592 ? ? 1.467 1.381 0.086 0.013 N 15 18 CZ A TYR 1592 ? ? CE2 A TYR 1592 ? ? 1.279 1.381 -0.102 0.013 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 1543 ? ? -40.85 -153.60 2 1 PRO A 1560 ? ? -52.18 109.21 3 1 SER A 1600 ? ? -79.61 -74.24 4 1 LYS A 1601 ? ? -98.13 -87.11 5 2 ASP A 1514 ? ? -45.53 -72.30 6 2 ASP A 1515 ? ? 45.73 -94.19 7 2 SER A 1543 ? ? -47.47 -151.14 8 2 LYS A 1544 ? ? -39.69 -26.42 9 2 LYS A 1579 ? ? -163.87 89.99 10 2 GLN A 1586 ? ? 64.63 -1.63 11 2 LYS A 1601 ? ? 68.49 81.58 12 3 LYS A 1509 ? ? 79.37 -29.87 13 3 ASN A 1511 ? ? -141.09 -28.39 14 3 SER A 1543 ? ? -46.62 -151.00 15 3 GLU A 1557 ? ? -91.87 39.57 16 3 ALA A 1577 ? ? -56.22 102.33 17 3 LYS A 1601 ? ? 66.02 -97.93 18 3 GLU A 1617 ? ? -94.01 40.48 19 3 ASN A 1622 ? ? -91.46 53.14 20 4 GLU A 1512 ? ? -64.52 1.11 21 4 ASP A 1514 ? ? -140.37 -42.16 22 4 ASP A 1515 ? ? -125.58 -168.41 23 4 SER A 1543 ? ? -37.58 -152.20 24 4 GLU A 1557 ? ? 54.82 -158.99 25 4 ASN A 1558 ? ? 69.93 -8.95 26 4 PRO A 1560 ? ? -37.80 137.30 27 4 ALA A 1577 ? ? -67.10 88.67 28 4 GLN A 1586 ? ? 68.56 -7.10 29 4 PRO A 1616 ? ? -69.75 64.45 30 4 ALA A 1618 ? ? 70.34 -43.14 31 4 THR A 1621 ? ? -132.00 -52.45 32 4 ASN A 1622 ? ? -138.03 -68.92 33 5 SER A 1543 ? ? -45.67 -150.79 34 5 LYS A 1544 ? ? -39.55 -37.22 35 5 PRO A 1560 ? ? -24.24 112.59 36 5 ALA A 1577 ? ? -68.92 79.16 37 5 ASP A 1585 ? ? 54.72 75.57 38 5 GLN A 1586 ? ? 68.16 -14.67 39 5 LYS A 1601 ? ? -162.33 116.64 40 5 GLU A 1617 ? ? -81.01 40.77 41 6 ASP A 1514 ? ? -49.47 -79.73 42 6 ASP A 1515 ? ? 62.16 -88.31 43 6 SER A 1543 ? ? -49.57 -150.46 44 6 LYS A 1544 ? ? -39.81 -28.12 45 6 PRO A 1560 ? ? -29.88 122.16 46 6 GLN A 1586 ? ? 73.78 -14.43 47 7 LYS A 1509 ? ? 69.29 117.68 48 7 SER A 1543 ? ? -46.50 -152.15 49 7 ASN A 1558 ? ? -146.82 -43.94 50 7 PRO A 1560 ? ? -32.95 113.11 51 7 PRO A 1561 ? ? -59.07 102.79 52 7 LYS A 1601 ? ? 71.03 114.31 53 7 PRO A 1616 ? ? -72.04 50.00 54 8 HIS A 1513 ? ? -140.54 -16.76 55 8 SER A 1543 ? ? -48.69 -151.16 56 8 SER A 1605 ? ? -109.42 -167.08 57 8 PRO A 1616 ? ? -58.16 52.13 58 8 ALA A 1618 ? ? 59.73 -173.07 59 8 ASN A 1622 ? ? -77.16 47.79 60 9 ASN A 1511 ? ? -140.75 -19.77 61 9 CYS A 1516 ? ? -104.34 51.50 62 9 ARG A 1535 ? ? -95.88 -61.57 63 9 SER A 1543 ? ? -43.09 -161.88 64 9 VAL A 1547 ? ? -162.07 119.46 65 9 PRO A 1560 ? ? -32.82 132.74 66 9 ALA A 1577 ? ? -65.16 74.90 67 9 ASP A 1594 ? ? 72.10 59.04 68 9 LYS A 1601 ? ? 67.63 -146.14 69 9 THR A 1621 ? ? -108.84 43.10 70 9 CYS A 1646 ? ? -175.40 135.29 71 10 ASP A 1514 ? ? -140.46 -59.01 72 10 SER A 1543 ? ? -46.92 -152.60 73 10 ASN A 1558 ? ? 160.21 -25.10 74 10 PRO A 1560 ? ? -35.80 132.14 75 10 ALA A 1577 ? ? -67.66 99.79 76 10 ASP A 1585 ? ? 53.46 70.38 77 10 GLN A 1586 ? ? 68.72 -14.23 78 10 LYS A 1601 ? ? -142.39 -77.64 79 10 ALA A 1618 ? ? 72.59 -170.42 80 10 THR A 1621 ? ? -131.11 -50.68 81 10 ASN A 1622 ? ? -136.34 -60.60 82 11 ASP A 1514 ? ? -71.34 -70.26 83 11 SER A 1543 ? ? -138.42 -153.61 84 11 GLU A 1557 ? ? -83.21 40.41 85 11 PRO A 1560 ? ? -36.13 122.84 86 11 PRO A 1561 ? ? -53.82 107.64 87 11 ALA A 1577 ? ? -69.09 90.81 88 11 ARG A 1580 ? ? -161.30 111.84 89 11 ASP A 1585 ? ? 61.46 61.19 90 12 SER A 1510 ? ? -175.02 106.76 91 12 ASP A 1515 ? ? 71.67 -72.18 92 12 SER A 1543 ? ? -45.99 -152.78 93 12 PRO A 1560 ? ? -29.40 125.69 94 12 ILE A 1572 ? ? 80.97 144.51 95 12 GLN A 1586 ? ? 58.82 18.25 96 12 ASP A 1594 ? ? 65.62 76.76 97 12 LYS A 1601 ? ? 67.67 -86.71 98 12 CYS A 1614 ? ? -67.48 99.51 99 12 GLU A 1617 ? ? -82.54 41.16 100 12 CYS A 1646 ? ? -169.44 116.45 101 12 PRO A 1648 ? ? -52.97 109.46 102 13 ASP A 1514 ? ? -131.28 -62.30 103 13 SER A 1543 ? ? -48.67 -150.32 104 13 LYS A 1544 ? ? -38.92 -30.75 105 13 ASN A 1556 ? ? -170.37 61.41 106 13 GLU A 1557 ? ? -157.58 -119.92 107 13 ALA A 1565 ? ? -170.22 125.54 108 13 ALA A 1577 ? ? -59.65 104.23 109 13 CYS A 1646 ? ? -172.06 -179.57 110 14 HIS A 1513 ? ? -138.67 -41.23 111 14 SER A 1522 ? ? -91.93 -60.86 112 14 SER A 1543 ? ? -41.25 -153.07 113 14 PRO A 1560 ? ? -27.63 129.61 114 14 ASP A 1585 ? ? -46.34 102.68 115 14 VAL A 1587 ? ? -164.69 104.54 116 14 SER A 1605 ? ? -113.20 -167.45 117 14 PRO A 1616 ? ? -68.03 73.22 118 15 LYS A 1509 ? ? -101.79 -64.99 119 15 ARG A 1535 ? ? -96.82 -70.11 120 15 SER A 1543 ? ? -40.46 -153.07 121 15 GLU A 1557 ? ? 66.45 -173.61 122 15 ASN A 1558 ? ? 76.31 -20.90 123 15 PRO A 1560 ? ? -32.26 130.26 124 15 VAL A 1574 ? ? -140.01 27.48 125 15 ASP A 1594 ? ? 63.67 72.50 126 15 SER A 1602 ? ? -59.61 109.84 127 16 SER A 1543 ? ? -44.28 -151.62 128 16 LYS A 1544 ? ? -36.03 -39.24 129 16 GLU A 1557 ? ? 65.66 -24.04 130 16 PRO A 1560 ? ? -32.82 145.52 131 16 SER A 1573 ? ? -65.44 95.71 132 16 ALA A 1577 ? ? -67.07 98.87 133 16 ARG A 1580 ? ? -165.84 110.98 134 16 GLN A 1586 ? ? 59.79 18.41 135 16 CYS A 1614 ? ? -59.63 95.68 136 16 PRO A 1616 ? ? -61.20 10.36 137 16 ALA A 1618 ? ? 64.64 -172.94 138 16 SER A 1628 ? ? -171.12 148.09 139 17 LYS A 1509 ? ? -93.09 55.21 140 17 ASN A 1511 ? ? -140.78 -48.92 141 17 SER A 1543 ? ? -45.91 -151.35 142 17 ASN A 1556 ? ? 165.31 -158.91 143 17 GLU A 1557 ? ? 83.49 178.72 144 17 ALA A 1565 ? ? -168.78 119.20 145 17 PRO A 1616 ? ? -76.34 44.79 146 18 LYS A 1509 ? ? 59.70 80.24 147 18 SER A 1510 ? ? -107.90 41.15 148 18 SER A 1543 ? ? -44.98 -151.67 149 18 LYS A 1544 ? ? -54.70 -6.90 150 18 GLU A 1557 ? ? -83.13 36.65 151 18 PRO A 1560 ? ? -33.20 126.93 152 18 GLN A 1586 ? ? 66.31 -15.23 153 18 CYS A 1646 ? ? -177.11 116.02 154 19 ASN A 1511 ? ? -170.50 -59.45 155 19 SER A 1543 ? ? -49.09 -151.99 156 19 ASP A 1594 ? ? 48.77 79.27 157 19 PRO A 1648 ? ? -58.29 104.29 158 20 HIS A 1513 ? ? -147.08 -60.72 159 20 SER A 1543 ? ? -43.86 -151.30 160 20 ASN A 1556 ? ? -177.73 -165.03 161 20 GLU A 1557 ? ? 79.57 -176.80 162 20 PRO A 1560 ? ? -36.23 112.32 163 20 PRO A 1561 ? ? -48.89 153.52 164 20 ALA A 1565 ? ? -170.22 141.62 165 20 ASP A 1585 ? ? -47.40 108.32 166 20 VAL A 1587 ? ? -161.13 105.71 167 20 LYS A 1601 ? ? -142.42 -71.87 168 20 PRO A 1620 ? ? -64.92 -175.94 169 20 THR A 1621 ? ? -79.94 42.17 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 PHE A 1567 ? ? 0.060 'SIDE CHAIN' 2 2 ARG A 1580 ? ? 0.090 'SIDE CHAIN' 3 3 TYR A 1549 ? ? 0.059 'SIDE CHAIN' 4 3 TYR A 1606 ? ? 0.073 'SIDE CHAIN' 5 4 ARG A 1615 ? ? 0.076 'SIDE CHAIN' 6 6 TYR A 1592 ? ? 0.088 'SIDE CHAIN' 7 7 TYR A 1549 ? ? 0.071 'SIDE CHAIN' 8 7 TYR A 1583 ? ? 0.054 'SIDE CHAIN' 9 8 TYR A 1606 ? ? 0.070 'SIDE CHAIN' 10 12 PHE A 1567 ? ? 0.075 'SIDE CHAIN' 11 12 TYR A 1592 ? ? 0.074 'SIDE CHAIN' 12 12 TYR A 1606 ? ? 0.050 'SIDE CHAIN' 13 14 TYR A 1542 ? ? 0.071 'SIDE CHAIN' 14 14 PHE A 1612 ? ? 0.068 'SIDE CHAIN' 15 15 TYR A 1549 ? ? 0.051 'SIDE CHAIN' 16 16 TYR A 1592 ? ? 0.064 'SIDE CHAIN' 17 16 TYR A 1606 ? ? 0.050 'SIDE CHAIN' 18 18 TYR A 1592 ? ? 0.052 'SIDE CHAIN' #