data_2L37 # _entry.id 2L37 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2L37 RCSB RCSB101899 WWPDB D_1000101899 # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L37 _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2010-09-08 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ng, Y.M.' 1 'Yang, Y.' 2 'Sze, K.H.' 3 'Zhang, X.' 4 'Zheng, Y.T.' 5 'Shaw, P.C.' 6 # _citation.id primary _citation.title ;Structural characterization and anti-HIV-1 activities of arginine/glutamate-rich polypeptide Luffin P1 from the seeds of sponge gourd (Luffa cylindrical). ; _citation.journal_abbrev J.Struct.Biol. _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year 2010 _citation.journal_id_ASTM JSBIEM _citation.country US _citation.journal_id_ISSN 1095-8657 _citation.journal_id_CSD 0803 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21195767 _citation.pdbx_database_id_DOI 10.1016/j.jsb.2010.12.007 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Ng, Y.M.' 1 primary 'Yang, Y.' 2 primary 'Sze, K.H.' 3 primary 'Zhang, X.' 4 primary 'Zheng, Y.T.' 5 primary 'Shaw, P.C.' 6 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Ribosome-inactivating protein luffin P1' _entity.formula_weight 5243.932 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.2.2.22 _entity.pdbx_mutation ? _entity.pdbx_fragment 'Luffin P1c (UNP residues 3-45)' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Arginine/glutamate-rich polypeptide, AGRP, Luffin P1a, Luffin P1b, Luffin P1c' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSPRTEYEACRVRCQVAEHGVERQRRCQQVCEKRLREREGRRE _entity_poly.pdbx_seq_one_letter_code_can GSPRTEYEACRVRCQVAEHGVERQRRCQQVCEKRLREREGRRE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 PRO n 1 4 ARG n 1 5 THR n 1 6 GLU n 1 7 TYR n 1 8 GLU n 1 9 ALA n 1 10 CYS n 1 11 ARG n 1 12 VAL n 1 13 ARG n 1 14 CYS n 1 15 GLN n 1 16 VAL n 1 17 ALA n 1 18 GLU n 1 19 HIS n 1 20 GLY n 1 21 VAL n 1 22 GLU n 1 23 ARG n 1 24 GLN n 1 25 ARG n 1 26 ARG n 1 27 CYS n 1 28 GLN n 1 29 GLN n 1 30 VAL n 1 31 CYS n 1 32 GLU n 1 33 LYS n 1 34 ARG n 1 35 LEU n 1 36 ARG n 1 37 GLU n 1 38 ARG n 1 39 GLU n 1 40 GLY n 1 41 ARG n 1 42 ARG n 1 43 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name loofa _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Luffa aegyptiaca' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3670 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pHis-SUMO _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RIP1_LUFCY _struct_ref.pdbx_db_accession P56568 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GSPRTEYEACRVRCQVAEHGVERQRRCQQVCEKRLREREGRRE _struct_ref.pdbx_align_begin 3 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2L37 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 43 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P56568 _struct_ref_seq.db_align_beg 3 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 45 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 43 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-1H COSY' 1 3 1 '2D 1H-1H TOCSY' 1 4 1 '2D 1H-1H NOESY' 1 5 1 '3D 1H-15N TOCSY' 1 6 1 '3D 1H-15N NOESY' 1 7 1 '3D HNHA' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.7 mM [U-90% 15N] Luffin P1-1, 20 mM sodium phosphate-2, 150 mM sodium chloride-3, 1 mM [U-99% 2H] TSP-4, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model Avance _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2L37 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L37 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L37 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 1 'Koradi, Billeter and Wuthrich' 'data analysis' Molmol ? 2 'Bruker Biospin' collection xwinnmr ? 3 Goddard 'chemical shift assignment' SPARKY ? 4 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 5 'Guntert, Mumenthaler and Wuthrich' refinement CYANA ? 6 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2L37 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L37 _struct.title '3D solution structure of arginine/glutamate-rich polypeptide Luffin P1 from the seeds of sponge gourd (Luffa cylindrical)' _struct.pdbx_descriptor 'Ribosome-inactivating protein luffin P1 (E.C.3.2.2.22)' _struct.pdbx_model_details 'closest to the average, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L37 _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text HYDROLASE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 3 ? GLU A 18 ? PRO A 3 GLU A 18 1 ? 16 HELX_P HELX_P2 2 VAL A 21 ? GLY A 40 ? VAL A 21 GLY A 40 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 31 SG ? ? A CYS 10 A CYS 31 1_555 ? ? ? ? ? ? ? 2.048 ? disulf2 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 27 SG ? ? A CYS 14 A CYS 27 1_555 ? ? ? ? ? ? ? 2.078 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 2L37 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 GLU 43 43 43 GLU GLU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-01-19 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'Luffin P1-1' 0.7 ? mM '[U-90% 15N]' 1 'sodium phosphate-2' 20 ? mM ? 1 'sodium chloride-3' 150 ? mM ? 1 TSP-4 1 ? mM '[U-99% 2H]' 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -153.95 73.26 2 1 PRO A 3 ? ? -69.74 78.69 3 1 ARG A 42 ? ? -173.43 123.52 4 2 SER A 2 ? ? -170.85 71.79 5 2 PRO A 3 ? ? -69.78 83.37 6 2 VAL A 16 ? ? -105.78 40.77 7 2 GLU A 22 ? ? -70.42 -73.22 8 4 PRO A 3 ? ? -69.76 80.33 9 4 VAL A 21 ? ? -107.56 -60.97 10 6 HIS A 19 ? ? -93.19 44.23 11 7 SER A 2 ? ? 60.27 68.55 12 7 THR A 5 ? ? -93.17 -63.84 13 7 ARG A 42 ? ? 53.97 90.38 14 9 SER A 2 ? ? -150.50 69.73 15 9 PRO A 3 ? ? -69.75 98.20 16 10 VAL A 21 ? ? -121.55 -60.49 17 10 ARG A 42 ? ? -68.92 88.44 18 11 ARG A 42 ? ? -106.29 74.59 19 12 PRO A 3 ? ? -69.78 91.42 20 15 SER A 2 ? ? 59.48 71.94 21 17 SER A 2 ? ? 54.64 70.87 22 17 VAL A 21 ? ? -109.04 -61.86 23 17 ARG A 42 ? ? -95.25 40.22 24 18 SER A 2 ? ? 53.09 73.30 25 18 HIS A 19 ? ? -117.48 50.10 26 19 SER A 2 ? ? 58.75 70.74 27 19 PRO A 3 ? ? -69.80 85.13 28 20 SER A 2 ? ? -160.67 68.97 29 20 PRO A 3 ? ? -69.77 82.50 30 20 GLU A 18 ? ? -172.22 116.27 #