data_2L6D # _entry.id 2L6D # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2L6D pdb_00002l6d 10.2210/pdb2l6d/pdb RCSB RCSB102013 ? ? WWPDB D_1000102013 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-11-23 2 'Structure model' 1 1 2011-12-14 3 'Structure model' 1 2 2012-02-01 4 'Structure model' 1 3 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_nmr_software 5 4 'Structure model' pdbx_nmr_spectrometer 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L6D _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-11-18 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2L6C _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Garcin, E.B.' 1 'Bornet, O.' 2 'Sebban-Kreuzer, C.' 3 'Guerlesquin, F.' 4 # _citation.id primary _citation.title 'Structural and mechanistic insights into unusual thiol disulfide oxidoreductase.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 287 _citation.page_first 1688 _citation.page_last 1697 _citation.year 2012 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22128175 _citation.pdbx_database_id_DOI 10.1074/jbc.M111.288316 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Garcin, E.B.' 1 ? primary 'Bornet, O.' 2 ? primary 'Elantak, L.' 3 ? primary 'Vita, N.' 4 ? primary 'Pieulle, L.' 5 ? primary 'Guerlesquin, F.' 6 ? primary 'Sebban-Kreuzer, C.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Thioredoxin _entity.formula_weight 12384.338 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSAIRDITTEAGMAHFEGLSDAIVFFHKNLCPHCKNMEKVLDKFGARAPQVAISSVDSEARPELMKELGFERVPTLVFIR DGKVAKVFSGIMNPRELQALYASIHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSAIRDITTEAGMAHFEGLSDAIVFFHKNLCPHCKNMEKVLDKFGARAPQVAISSVDSEARPELMKELGFERVPTLVFIR DGKVAKVFSGIMNPRELQALYASIHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 ALA n 1 4 ILE n 1 5 ARG n 1 6 ASP n 1 7 ILE n 1 8 THR n 1 9 THR n 1 10 GLU n 1 11 ALA n 1 12 GLY n 1 13 MET n 1 14 ALA n 1 15 HIS n 1 16 PHE n 1 17 GLU n 1 18 GLY n 1 19 LEU n 1 20 SER n 1 21 ASP n 1 22 ALA n 1 23 ILE n 1 24 VAL n 1 25 PHE n 1 26 PHE n 1 27 HIS n 1 28 LYS n 1 29 ASN n 1 30 LEU n 1 31 CYS n 1 32 PRO n 1 33 HIS n 1 34 CYS n 1 35 LYS n 1 36 ASN n 1 37 MET n 1 38 GLU n 1 39 LYS n 1 40 VAL n 1 41 LEU n 1 42 ASP n 1 43 LYS n 1 44 PHE n 1 45 GLY n 1 46 ALA n 1 47 ARG n 1 48 ALA n 1 49 PRO n 1 50 GLN n 1 51 VAL n 1 52 ALA n 1 53 ILE n 1 54 SER n 1 55 SER n 1 56 VAL n 1 57 ASP n 1 58 SER n 1 59 GLU n 1 60 ALA n 1 61 ARG n 1 62 PRO n 1 63 GLU n 1 64 LEU n 1 65 MET n 1 66 LYS n 1 67 GLU n 1 68 LEU n 1 69 GLY n 1 70 PHE n 1 71 GLU n 1 72 ARG n 1 73 VAL n 1 74 PRO n 1 75 THR n 1 76 LEU n 1 77 VAL n 1 78 PHE n 1 79 ILE n 1 80 ARG n 1 81 ASP n 1 82 GLY n 1 83 LYS n 1 84 VAL n 1 85 ALA n 1 86 LYS n 1 87 VAL n 1 88 PHE n 1 89 SER n 1 90 GLY n 1 91 ILE n 1 92 MET n 1 93 ASN n 1 94 PRO n 1 95 ARG n 1 96 GLU n 1 97 LEU n 1 98 GLN n 1 99 ALA n 1 100 LEU n 1 101 TYR n 1 102 ALA n 1 103 SER n 1 104 ILE n 1 105 HIS n 1 106 HIS n 1 107 HIS n 1 108 HIS n 1 109 HIS n 1 110 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene DVU_0378 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'Hildenborough / ATCC 29579 / NCIMB 8303' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Desulfovibrio vulgaris' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 882 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pJF _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 HIS 15 15 15 HIS HIS A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 MET 65 65 65 MET MET A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 MET 92 92 92 MET MET A . n A 1 93 ASN 93 93 93 ASN ASN A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 TYR 101 101 101 TYR TYR A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 HIS 105 105 ? ? ? A . n A 1 106 HIS 106 106 ? ? ? A . n A 1 107 HIS 107 107 ? ? ? A . n A 1 108 HIS 108 108 ? ? ? A . n A 1 109 HIS 109 109 ? ? ? A . n A 1 110 HIS 110 110 ? ? ? A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2L6D _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L6D _struct.title 'Solution structure of desulfothioredoxin from Desulfovibrio vulgaris Hildenborough in its reduced form' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L6D _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'thioredoxin fold, OXIDOREDUCTASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q72F37_DESVH _struct_ref.pdbx_db_accession Q72F37 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSAIRDITTEAGMAHFEGLSDAIVFFHKNLCPHCKNMEKVLDKFGARAPQVAISSVDSEARPELMKELGFERVPTLVFIR DGKVAKVFSGIMNPRELQALYASI ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2L6D _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 104 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q72F37 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 104 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 104 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2L6D HIS A 105 ? UNP Q72F37 ? ? 'expression tag' 105 1 1 2L6D HIS A 106 ? UNP Q72F37 ? ? 'expression tag' 106 2 1 2L6D HIS A 107 ? UNP Q72F37 ? ? 'expression tag' 107 3 1 2L6D HIS A 108 ? UNP Q72F37 ? ? 'expression tag' 108 4 1 2L6D HIS A 109 ? UNP Q72F37 ? ? 'expression tag' 109 5 1 2L6D HIS A 110 ? UNP Q72F37 ? ? 'expression tag' 110 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 12 ? GLU A 17 ? GLY A 12 GLU A 17 1 ? 6 HELX_P HELX_P2 2 CYS A 34 ? ARG A 47 ? CYS A 34 ARG A 47 1 ? 14 HELX_P HELX_P3 3 ARG A 61 ? GLY A 69 ? ARG A 61 GLY A 69 1 ? 9 HELX_P HELX_P4 4 ASN A 93 ? ILE A 104 ? ASN A 93 ILE A 104 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 52 ? ASP A 57 ? ALA A 52 ASP A 57 A 2 ASP A 21 ? HIS A 27 ? ASP A 21 HIS A 27 A 3 THR A 75 ? ARG A 80 ? THR A 75 ARG A 80 A 4 LYS A 83 ? SER A 89 ? LYS A 83 SER A 89 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ALA A 52 ? O ALA A 52 N ILE A 23 ? N ILE A 23 A 2 3 N VAL A 24 ? N VAL A 24 O VAL A 77 ? O VAL A 77 A 3 4 N ARG A 80 ? N ARG A 80 O LYS A 83 ? O LYS A 83 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 72 ? ? CZ A ARG 72 ? ? NH1 A ARG 72 ? ? 123.73 120.30 3.43 0.50 N 2 2 NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 123.99 120.30 3.69 0.50 N 3 2 NE A ARG 95 ? ? CZ A ARG 95 ? ? NH1 A ARG 95 ? ? 123.58 120.30 3.28 0.50 N 4 2 NE A ARG 95 ? ? CZ A ARG 95 ? ? NH2 A ARG 95 ? ? 116.93 120.30 -3.37 0.50 N 5 3 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 124.78 120.30 4.48 0.50 N 6 3 NE A ARG 61 ? ? CZ A ARG 61 ? ? NH1 A ARG 61 ? ? 123.54 120.30 3.24 0.50 N 7 3 NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 123.44 120.30 3.14 0.50 N 8 6 NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 124.18 120.30 3.88 0.50 N 9 7 NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 123.96 120.30 3.66 0.50 N 10 7 NE A ARG 95 ? ? CZ A ARG 95 ? ? NH2 A ARG 95 ? ? 117.30 120.30 -3.00 0.50 N 11 8 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH1 A ARG 5 ? ? 123.72 120.30 3.42 0.50 N 12 8 NE A ARG 5 ? ? CZ A ARG 5 ? ? NH2 A ARG 5 ? ? 117.01 120.30 -3.29 0.50 N 13 8 NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 123.55 120.30 3.25 0.50 N 14 9 NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 123.36 120.30 3.06 0.50 N 15 10 NE A ARG 72 ? ? CZ A ARG 72 ? ? NH2 A ARG 72 ? ? 117.07 120.30 -3.23 0.50 N 16 11 NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 123.88 120.30 3.58 0.50 N 17 12 NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 123.44 120.30 3.14 0.50 N 18 12 NE A ARG 95 ? ? CZ A ARG 95 ? ? NH2 A ARG 95 ? ? 117.27 120.30 -3.03 0.50 N 19 13 NE A ARG 61 ? ? CZ A ARG 61 ? ? NH1 A ARG 61 ? ? 123.36 120.30 3.06 0.50 N 20 13 NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 123.34 120.30 3.04 0.50 N 21 14 NE A ARG 61 ? ? CZ A ARG 61 ? ? NH1 A ARG 61 ? ? 123.72 120.30 3.42 0.50 N 22 14 NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 123.76 120.30 3.46 0.50 N 23 15 NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 124.89 120.30 4.59 0.50 N 24 16 NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 124.14 120.30 3.84 0.50 N 25 18 NE A ARG 61 ? ? CZ A ARG 61 ? ? NH1 A ARG 61 ? ? 123.40 120.30 3.10 0.50 N 26 19 NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 123.83 120.30 3.53 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 71 ? ? -94.42 -72.49 2 1 ARG A 72 ? ? -159.27 15.99 3 1 PRO A 74 ? ? -66.31 91.28 4 2 SER A 2 ? ? 71.90 -57.32 5 2 ALA A 3 ? ? -82.75 36.15 6 2 GLU A 10 ? ? -152.97 -20.33 7 2 ASP A 21 ? ? -164.96 114.62 8 2 ASN A 29 ? ? -39.00 -94.45 9 2 ALA A 48 ? ? -149.68 45.44 10 2 GLU A 71 ? ? -102.58 -70.60 11 2 ARG A 72 ? ? -157.34 3.58 12 2 PRO A 74 ? ? -63.66 93.33 13 2 MET A 92 ? ? -147.36 -149.06 14 3 CYS A 31 ? ? -47.59 108.51 15 3 GLU A 71 ? ? -77.29 -77.17 16 4 GLU A 10 ? ? -178.15 141.23 17 4 ARG A 72 ? ? -157.04 1.67 18 4 PRO A 74 ? ? -67.86 91.70 19 5 ILE A 7 ? ? -104.14 60.84 20 5 ASN A 29 ? ? -47.57 -102.90 21 5 GLU A 71 ? ? -80.91 -75.20 22 5 ARG A 72 ? ? -161.13 13.41 23 6 SER A 2 ? ? -76.89 42.57 24 6 ASP A 6 ? ? -57.48 109.67 25 6 LEU A 30 ? ? 67.61 -30.80 26 6 ALA A 48 ? ? -146.75 48.83 27 6 ARG A 72 ? ? -160.41 -0.35 28 7 ALA A 11 ? ? -73.08 31.00 29 7 GLU A 17 ? ? -65.91 82.28 30 7 ALA A 48 ? ? -144.66 41.80 31 7 ARG A 61 ? ? -116.72 52.92 32 7 ARG A 72 ? ? 168.67 17.23 33 8 GLU A 10 ? ? -165.97 89.60 34 8 ASP A 21 ? ? -160.46 109.05 35 8 ALA A 48 ? ? -145.36 50.89 36 8 GLU A 71 ? ? -96.00 -62.62 37 8 ARG A 72 ? ? -157.47 2.63 38 9 SER A 2 ? ? 55.56 -121.97 39 9 ARG A 61 ? ? -116.26 65.22 40 9 GLU A 71 ? ? -101.85 -61.81 41 9 ARG A 72 ? ? -170.98 70.73 42 10 THR A 9 ? ? -94.46 -76.20 43 10 ALA A 11 ? ? -78.63 44.62 44 10 LEU A 30 ? ? -81.68 -83.90 45 10 ARG A 72 ? ? -169.83 7.57 46 11 GLU A 10 ? ? -153.96 -19.08 47 11 ASP A 21 ? ? -160.08 115.22 48 11 ASP A 57 ? ? -65.19 97.66 49 11 ARG A 61 ? ? -115.39 54.23 50 11 GLU A 71 ? ? -102.33 -61.11 51 11 ARG A 72 ? ? -162.69 2.31 52 11 PRO A 74 ? ? -68.70 88.58 53 12 ALA A 3 ? ? 70.48 143.66 54 12 ILE A 7 ? ? -118.33 76.99 55 12 GLU A 10 ? ? -133.06 -31.05 56 12 ARG A 72 ? ? -179.82 -3.12 57 13 THR A 8 ? ? -127.88 -100.19 58 13 THR A 9 ? ? -144.47 -53.46 59 13 ALA A 11 ? ? -150.72 36.04 60 13 ASN A 29 ? ? -31.08 -82.16 61 13 ARG A 72 ? ? 79.31 59.93 62 13 PRO A 74 ? ? -64.57 96.18 63 14 SER A 2 ? ? -158.36 -114.10 64 14 ALA A 48 ? ? -150.20 66.23 65 14 VAL A 56 ? ? -173.55 133.76 66 14 GLU A 71 ? ? -78.45 -81.04 67 14 ARG A 72 ? ? -157.35 6.64 68 14 PRO A 74 ? ? -61.60 93.34 69 15 ALA A 3 ? ? -170.43 146.66 70 15 GLU A 10 ? ? -171.62 145.34 71 15 PHE A 16 ? ? -75.65 27.27 72 15 LEU A 30 ? ? 67.85 -46.41 73 15 GLU A 71 ? ? -92.25 -72.21 74 15 ARG A 72 ? ? -162.81 3.77 75 15 PRO A 74 ? ? -67.48 96.35 76 16 ASP A 21 ? ? -164.76 114.88 77 16 ASN A 29 ? ? 17.76 -104.57 78 16 ALA A 48 ? ? -144.05 42.31 79 16 GLU A 71 ? ? -108.75 -68.77 80 16 ARG A 72 ? ? -164.79 22.42 81 17 SER A 2 ? ? 69.82 -56.03 82 17 ARG A 5 ? ? 165.89 -42.98 83 17 ASP A 6 ? ? 175.23 133.91 84 17 ARG A 72 ? ? -167.07 23.05 85 18 GLU A 10 ? ? -96.94 50.11 86 18 GLU A 71 ? ? 73.71 -29.07 87 18 ARG A 72 ? ? -163.89 17.73 88 19 SER A 2 ? ? 70.41 -36.09 89 19 GLU A 10 ? ? -170.77 145.59 90 19 GLU A 71 ? ? -89.39 -72.16 91 19 ARG A 72 ? ? -168.46 30.18 92 19 PRO A 74 ? ? -60.95 97.60 93 20 SER A 2 ? ? 108.08 -26.74 94 20 GLU A 10 ? ? -163.20 74.49 95 20 GLU A 71 ? ? -103.38 -65.85 96 20 ARG A 72 ? ? -159.99 2.16 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 3 _pdbx_validate_peptide_omega.auth_comp_id_1 LEU _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 19 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 SER _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 20 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 143.24 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L6D _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L6D _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '1 mM [U-99% 13C; U-99% 15N] reduced desulfothioredoxin, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample.component 'reduced desulfothioredoxin' _pdbx_nmr_exptl_sample.concentration 1 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-99% 13C; U-99% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 290 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '2D 1H-1H TOCSY' 1 4 1 '2D 1H-1H NOESY' 1 5 1 '3D CBCA(CO)NH' 1 6 1 '3D HNCO' 1 7 1 '3D HNCA' 1 8 1 '3D HNCACB' 1 9 1 '3D HBHA(CO)NH' 1 10 1 '3D HN(CO)CA' 1 11 1 '3D HCCH-TOCSY' 1 12 1 '3D 1H-15N NOESY' 1 13 1 '3D 1H-13C NOESY' 1 14 1 '2D 1H-15N HSQC' 1 15 1 '2D 1H-13C HSQC' 1 16 1 '2D 1H-1H TOCSY' 1 17 1 '2D 1H-1H NOESY' 1 18 1 '3D CBCA(CO)NH' 1 19 1 '3D HNCACB' 1 20 1 '3D HNCA' 1 21 1 '3D HN(CO)CA' 1 22 1 '3D HNCO' 1 23 1 '3D HBHA(CO)NH' 1 24 1 '3D HCCH-TOCSY' 1 25 1 '3D 1H-15N NOESY' 1 26 1 '3D 1H-13C NOESY' # _pdbx_nmr_refine.entry_id 2L6D _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Keller and Wuthrich' 'chemical shift assignment' CARA ? 1 'Case, D.A. et al.' refinement Amber ? 2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 105 ? A HIS 105 2 1 Y 1 A HIS 106 ? A HIS 106 3 1 Y 1 A HIS 107 ? A HIS 107 4 1 Y 1 A HIS 108 ? A HIS 108 5 1 Y 1 A HIS 109 ? A HIS 109 6 1 Y 1 A HIS 110 ? A HIS 110 7 2 Y 1 A HIS 105 ? A HIS 105 8 2 Y 1 A HIS 106 ? A HIS 106 9 2 Y 1 A HIS 107 ? A HIS 107 10 2 Y 1 A HIS 108 ? A HIS 108 11 2 Y 1 A HIS 109 ? A HIS 109 12 2 Y 1 A HIS 110 ? A HIS 110 13 3 Y 1 A HIS 105 ? A HIS 105 14 3 Y 1 A HIS 106 ? A HIS 106 15 3 Y 1 A HIS 107 ? A HIS 107 16 3 Y 1 A HIS 108 ? A HIS 108 17 3 Y 1 A HIS 109 ? A HIS 109 18 3 Y 1 A HIS 110 ? A HIS 110 19 4 Y 1 A HIS 105 ? A HIS 105 20 4 Y 1 A HIS 106 ? A HIS 106 21 4 Y 1 A HIS 107 ? A HIS 107 22 4 Y 1 A HIS 108 ? A HIS 108 23 4 Y 1 A HIS 109 ? A HIS 109 24 4 Y 1 A HIS 110 ? A HIS 110 25 5 Y 1 A HIS 105 ? A HIS 105 26 5 Y 1 A HIS 106 ? A HIS 106 27 5 Y 1 A HIS 107 ? A HIS 107 28 5 Y 1 A HIS 108 ? A HIS 108 29 5 Y 1 A HIS 109 ? A HIS 109 30 5 Y 1 A HIS 110 ? A HIS 110 31 6 Y 1 A HIS 105 ? A HIS 105 32 6 Y 1 A HIS 106 ? A HIS 106 33 6 Y 1 A HIS 107 ? A HIS 107 34 6 Y 1 A HIS 108 ? A HIS 108 35 6 Y 1 A HIS 109 ? A HIS 109 36 6 Y 1 A HIS 110 ? A HIS 110 37 7 Y 1 A HIS 105 ? A HIS 105 38 7 Y 1 A HIS 106 ? A HIS 106 39 7 Y 1 A HIS 107 ? A HIS 107 40 7 Y 1 A HIS 108 ? A HIS 108 41 7 Y 1 A HIS 109 ? A HIS 109 42 7 Y 1 A HIS 110 ? A HIS 110 43 8 Y 1 A HIS 105 ? A HIS 105 44 8 Y 1 A HIS 106 ? A HIS 106 45 8 Y 1 A HIS 107 ? A HIS 107 46 8 Y 1 A HIS 108 ? A HIS 108 47 8 Y 1 A HIS 109 ? A HIS 109 48 8 Y 1 A HIS 110 ? A HIS 110 49 9 Y 1 A HIS 105 ? A HIS 105 50 9 Y 1 A HIS 106 ? A HIS 106 51 9 Y 1 A HIS 107 ? A HIS 107 52 9 Y 1 A HIS 108 ? A HIS 108 53 9 Y 1 A HIS 109 ? A HIS 109 54 9 Y 1 A HIS 110 ? A HIS 110 55 10 Y 1 A HIS 105 ? A HIS 105 56 10 Y 1 A HIS 106 ? A HIS 106 57 10 Y 1 A HIS 107 ? A HIS 107 58 10 Y 1 A HIS 108 ? A HIS 108 59 10 Y 1 A HIS 109 ? A HIS 109 60 10 Y 1 A HIS 110 ? A HIS 110 61 11 Y 1 A HIS 105 ? A HIS 105 62 11 Y 1 A HIS 106 ? A HIS 106 63 11 Y 1 A HIS 107 ? A HIS 107 64 11 Y 1 A HIS 108 ? A HIS 108 65 11 Y 1 A HIS 109 ? A HIS 109 66 11 Y 1 A HIS 110 ? A HIS 110 67 12 Y 1 A HIS 105 ? A HIS 105 68 12 Y 1 A HIS 106 ? A HIS 106 69 12 Y 1 A HIS 107 ? A HIS 107 70 12 Y 1 A HIS 108 ? A HIS 108 71 12 Y 1 A HIS 109 ? A HIS 109 72 12 Y 1 A HIS 110 ? A HIS 110 73 13 Y 1 A HIS 105 ? A HIS 105 74 13 Y 1 A HIS 106 ? A HIS 106 75 13 Y 1 A HIS 107 ? A HIS 107 76 13 Y 1 A HIS 108 ? A HIS 108 77 13 Y 1 A HIS 109 ? A HIS 109 78 13 Y 1 A HIS 110 ? A HIS 110 79 14 Y 1 A HIS 105 ? A HIS 105 80 14 Y 1 A HIS 106 ? A HIS 106 81 14 Y 1 A HIS 107 ? A HIS 107 82 14 Y 1 A HIS 108 ? A HIS 108 83 14 Y 1 A HIS 109 ? A HIS 109 84 14 Y 1 A HIS 110 ? A HIS 110 85 15 Y 1 A HIS 105 ? A HIS 105 86 15 Y 1 A HIS 106 ? A HIS 106 87 15 Y 1 A HIS 107 ? A HIS 107 88 15 Y 1 A HIS 108 ? A HIS 108 89 15 Y 1 A HIS 109 ? A HIS 109 90 15 Y 1 A HIS 110 ? A HIS 110 91 16 Y 1 A HIS 105 ? A HIS 105 92 16 Y 1 A HIS 106 ? A HIS 106 93 16 Y 1 A HIS 107 ? A HIS 107 94 16 Y 1 A HIS 108 ? A HIS 108 95 16 Y 1 A HIS 109 ? A HIS 109 96 16 Y 1 A HIS 110 ? A HIS 110 97 17 Y 1 A HIS 105 ? A HIS 105 98 17 Y 1 A HIS 106 ? A HIS 106 99 17 Y 1 A HIS 107 ? A HIS 107 100 17 Y 1 A HIS 108 ? A HIS 108 101 17 Y 1 A HIS 109 ? A HIS 109 102 17 Y 1 A HIS 110 ? A HIS 110 103 18 Y 1 A HIS 105 ? A HIS 105 104 18 Y 1 A HIS 106 ? A HIS 106 105 18 Y 1 A HIS 107 ? A HIS 107 106 18 Y 1 A HIS 108 ? A HIS 108 107 18 Y 1 A HIS 109 ? A HIS 109 108 18 Y 1 A HIS 110 ? A HIS 110 109 19 Y 1 A HIS 105 ? A HIS 105 110 19 Y 1 A HIS 106 ? A HIS 106 111 19 Y 1 A HIS 107 ? A HIS 107 112 19 Y 1 A HIS 108 ? A HIS 108 113 19 Y 1 A HIS 109 ? A HIS 109 114 19 Y 1 A HIS 110 ? A HIS 110 115 20 Y 1 A HIS 105 ? A HIS 105 116 20 Y 1 A HIS 106 ? A HIS 106 117 20 Y 1 A HIS 107 ? A HIS 107 118 20 Y 1 A HIS 108 ? A HIS 108 119 20 Y 1 A HIS 109 ? A HIS 109 120 20 Y 1 A HIS 110 ? A HIS 110 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2L6D _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_