data_2L7S # _entry.id 2L7S # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2L7S pdb_00002l7s 10.2210/pdb2l7s/pdb RCSB RCSB102063 ? ? BMRB 17372 ? ? WWPDB D_1000102063 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 2FLY PDB . unspecified 17372 BMRB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L7S _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-12-21 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Jimenez-Barbero, J.' 1 'Perez-Castells, J.' 2 'Nieto, L.' 3 # _citation.id primary _citation.title 'Structure of micelle-bound adrenomedullin: a first step toward the analysis of its interactions with receptors and small molecules.' _citation.journal_abbrev Biopolymers _citation.journal_volume 97 _citation.page_first 45 _citation.page_last 53 _citation.year 2012 _citation.journal_id_ASTM BIPMAA _citation.country US _citation.journal_id_ISSN 0006-3525 _citation.journal_id_CSD 0161 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21830197 _citation.pdbx_database_id_DOI 10.1002/bip.21700 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Perez-Castells, J.' 1 ? primary 'Martin-Santamaria, S.' 2 ? primary 'Nieto, L.' 3 ? primary 'Ramos, A.' 4 ? primary 'Martinez, A.' 5 ? primary 'Pascual-Teresa, B.' 6 ? primary 'Jimenez-Barbero, J.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Adrenomedullin _entity.formula_weight 6038.813 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ADM, AM' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY(NH2)' _entity_poly.pdbx_seq_one_letter_code_can YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGYX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 TYR n 1 2 ARG n 1 3 GLN n 1 4 SER n 1 5 MET n 1 6 ASN n 1 7 ASN n 1 8 PHE n 1 9 GLN n 1 10 GLY n 1 11 LEU n 1 12 ARG n 1 13 SER n 1 14 PHE n 1 15 GLY n 1 16 CYS n 1 17 ARG n 1 18 PHE n 1 19 GLY n 1 20 THR n 1 21 CYS n 1 22 THR n 1 23 VAL n 1 24 GLN n 1 25 LYS n 1 26 LEU n 1 27 ALA n 1 28 HIS n 1 29 GLN n 1 30 ILE n 1 31 TYR n 1 32 GLN n 1 33 PHE n 1 34 THR n 1 35 ASP n 1 36 LYS n 1 37 ASP n 1 38 LYS n 1 39 ASP n 1 40 ASN n 1 41 VAL n 1 42 ALA n 1 43 PRO n 1 44 ARG n 1 45 SER n 1 46 LYS n 1 47 ILE n 1 48 SER n 1 49 PRO n 1 50 GLN n 1 51 GLY n 1 52 TYR n 1 53 NH2 n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ADM, AM' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ADML_HUMAN _struct_ref.pdbx_db_accession P35318 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY _struct_ref.pdbx_align_begin 95 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2L7S _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 52 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P35318 _struct_ref_seq.db_align_beg 95 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 146 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 52 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2L7S _struct_ref_seq_dif.mon_id NH2 _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 53 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P35318 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details amidation _struct_ref_seq_dif.pdbx_auth_seq_num 53 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H TOCSY' 1 2 1 '2D 1H-1H NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.33 mM AM, 20 mM sodium phosphate, 23 mM [U-2H] SDS, 90 % H2O, 10 % [U-99% 2H] D2O, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2L7S _pdbx_nmr_refine.method 'simulated annealing, molecular dynamics' _pdbx_nmr_refine.details 'Energy minimization' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L7S _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L7S _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 1 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 2.1 2 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollm' refinement Amber 8 3 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollm' 'energy minimization' Amber 8 4 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2L7S _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L7S _struct.title ;Determination of the three-dimensional structure of adrenomedullin, a first step towards the analysis of its interactions with receptors and small molecules ; _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L7S _struct_keywords.pdbx_keywords HORMONE _struct_keywords.text 'hormone, pre-pro-adrenomedullin' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 22 ? TYR A 31 ? THR A 22 TYR A 31 1 ? 10 HELX_P HELX_P2 2 ALA A 42 ? ILE A 47 ? ALA A 42 ILE A 47 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 21 SG ? ? A CYS 16 A CYS 21 1_555 ? ? ? ? ? ? ? 1.946 ? ? covale1 covale both ? A TYR 52 C ? ? ? 1_555 A NH2 53 N ? ? A TYR 52 A NH2 53 1_555 ? ? ? ? ? ? ? 1.326 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _atom_sites.entry_id 2L7S _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 TYR 1 1 1 TYR TYR A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 MET 5 5 5 MET MET A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 NH2 53 53 53 NH2 NH2 A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-09-28 2 'Structure model' 1 1 2012-01-18 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' struct_conn 6 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' 6 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 7 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id AM-1 0.33 ? mM ? 1 'sodium phosphate-2' 20 ? mM ? 1 SDS-3 23 ? mM '[U-2H]' 1 H2O-4 90 ? % ? 1 D2O-5 10 ? % '[U-99% 2H]' 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2L7S _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 2338 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 957 _pdbx_nmr_constraints.NOE_long_range_total_count 27 _pdbx_nmr_constraints.NOE_medium_range_total_count 235 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 695 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 6 ? ? -179.24 -169.98 2 1 ASN A 7 ? ? -175.62 133.77 3 1 PHE A 8 ? ? -179.80 -176.17 4 1 SER A 13 ? ? -93.96 37.13 5 1 PHE A 14 ? ? 179.89 149.31 6 1 CYS A 21 ? ? -160.67 52.50 7 1 LYS A 46 ? ? -68.88 -72.32 8 2 ARG A 2 ? ? -149.83 -46.32 9 2 SER A 13 ? ? -95.60 34.30 10 2 PHE A 14 ? ? -179.95 149.38 11 2 LYS A 38 ? ? -53.85 -76.04 12 2 SER A 45 ? ? -106.84 57.91 13 2 LYS A 46 ? ? -114.86 67.62 14 2 SER A 48 ? ? -150.71 73.22 15 2 GLN A 50 ? ? 60.39 83.22 16 3 ARG A 2 ? ? -144.02 -70.89 17 3 ASN A 6 ? ? -59.02 -175.67 18 3 PHE A 8 ? ? -57.22 -177.07 19 3 PHE A 14 ? ? -179.80 149.63 20 3 ARG A 17 ? ? -54.32 -74.03 21 3 LYS A 38 ? ? -61.50 -166.20 22 3 ASN A 40 ? ? 63.66 91.67 23 4 ARG A 2 ? ? -148.34 -42.90 24 4 MET A 5 ? ? -101.27 -69.97 25 4 SER A 13 ? ? -57.53 -74.02 26 4 PHE A 14 ? ? 179.25 144.15 27 4 THR A 34 ? ? -123.52 -67.60 28 4 ASP A 35 ? ? 51.60 88.51 29 4 ASP A 39 ? ? -92.46 46.33 30 5 ASN A 7 ? ? -179.77 143.45 31 5 PHE A 8 ? ? -57.57 -176.04 32 5 PHE A 14 ? ? 179.37 143.52 33 5 CYS A 21 ? ? 176.69 120.79 34 5 LYS A 36 ? ? -64.52 -76.17 35 5 GLN A 50 ? ? 60.37 99.43 36 6 ASN A 7 ? ? -64.55 -74.57 37 6 PHE A 14 ? ? 179.93 149.08 38 6 CYS A 21 ? ? -175.22 124.44 39 6 THR A 34 ? ? -122.40 -59.41 40 7 ASN A 7 ? ? -179.60 100.95 41 7 PHE A 14 ? ? -147.99 -77.14 42 7 ASP A 35 ? ? 52.97 89.97 43 8 ASN A 7 ? ? -177.83 107.05 44 8 PHE A 8 ? ? -178.14 -175.74 45 8 PHE A 14 ? ? 179.51 144.60 46 8 THR A 34 ? ? -131.03 -42.52 47 8 ASP A 35 ? ? 61.40 65.23 48 8 ASP A 37 ? ? -57.61 -178.04 49 8 ASP A 39 ? ? -154.35 65.09 50 9 ARG A 2 ? ? -55.01 174.26 51 9 MET A 5 ? ? -90.91 -74.85 52 9 ASN A 7 ? ? -155.23 37.91 53 9 PHE A 14 ? ? -76.94 -74.65 54 9 ASP A 35 ? ? 59.01 97.49 55 9 LYS A 36 ? ? -110.16 -71.42 56 9 SER A 48 ? ? -160.14 74.18 57 9 GLN A 50 ? ? 65.14 67.43 58 10 PHE A 14 ? ? -179.69 149.37 59 10 CYS A 21 ? ? -178.75 106.88 60 10 THR A 22 ? ? -176.07 -179.53 61 10 ASP A 37 ? ? -57.14 -177.58 62 11 ARG A 2 ? ? -176.51 86.45 63 11 PHE A 8 ? ? -55.60 179.86 64 11 PHE A 14 ? ? 179.33 144.07 65 11 ASP A 35 ? ? 54.57 82.47 66 11 LYS A 36 ? ? -92.74 -64.67 67 12 ARG A 2 ? ? -137.00 -36.99 68 12 PHE A 8 ? ? -55.99 -179.89 69 12 PHE A 14 ? ? 179.00 144.22 70 12 CYS A 21 ? ? -177.47 90.79 71 12 THR A 34 ? ? -135.82 -40.46 72 12 ASP A 37 ? ? -57.53 -177.03 73 12 SER A 48 ? ? -153.05 73.31 74 12 GLN A 50 ? ? 60.21 98.45 75 13 PHE A 14 ? ? 178.87 145.70 76 13 PHE A 18 ? ? -165.07 107.95 77 13 CYS A 21 ? ? 177.62 108.42 78 13 ASP A 37 ? ? -60.41 -176.93 79 13 PRO A 49 ? ? -69.74 4.80 80 13 GLN A 50 ? ? -38.29 -75.97 81 14 GLN A 9 ? ? -64.65 -71.23 82 14 ARG A 12 ? ? -94.08 31.31 83 14 PHE A 14 ? ? 179.24 144.70 84 14 THR A 34 ? ? -130.38 -42.58 85 14 ASP A 35 ? ? 61.02 74.93 86 14 ASN A 40 ? ? 56.37 73.60 87 14 PRO A 49 ? ? -69.72 3.34 88 15 PHE A 8 ? ? -58.36 -174.75 89 15 PHE A 14 ? ? -176.62 148.90 90 15 ARG A 17 ? ? 75.39 -4.58 91 15 PHE A 18 ? ? -173.29 115.35 92 15 CYS A 21 ? ? -179.76 66.06 93 15 LYS A 36 ? ? -57.53 179.95 94 15 ASP A 37 ? ? 62.06 81.80 95 15 SER A 48 ? ? -119.05 69.54 96 16 ARG A 2 ? ? -168.11 28.93 97 16 MET A 5 ? ? -170.41 137.45 98 16 PHE A 8 ? ? -58.88 -174.76 99 16 PHE A 14 ? ? 179.35 144.10 100 16 ASP A 35 ? ? 51.46 71.79 101 16 ASN A 40 ? ? 174.67 102.56 102 17 ASN A 7 ? ? -117.30 60.45 103 17 PHE A 8 ? ? -172.47 -174.42 104 17 GLN A 9 ? ? -76.41 -73.34 105 17 PHE A 14 ? ? 179.12 144.73 106 17 THR A 34 ? ? -137.04 -40.85 107 17 ASP A 35 ? ? 58.10 70.66 108 17 LYS A 38 ? ? -65.92 -173.95 109 17 LYS A 46 ? ? -111.35 74.46 110 17 SER A 48 ? ? -166.70 72.20 111 18 PHE A 14 ? ? -111.86 -77.77 112 18 CYS A 16 ? ? -155.25 82.71 113 18 THR A 34 ? ? -122.90 -66.65 114 18 SER A 48 ? ? -154.14 73.40 115 19 SER A 4 ? ? -61.82 -177.88 116 19 PHE A 8 ? ? -58.05 -175.79 117 19 PHE A 14 ? ? 179.19 144.74 118 19 GLN A 24 ? ? -65.74 -72.27 119 19 LYS A 36 ? ? -62.90 -74.29 120 20 PHE A 8 ? ? -175.28 -175.95 121 20 PHE A 14 ? ? -179.34 142.13 122 20 ARG A 17 ? ? 74.37 -61.00 123 20 THR A 20 ? ? 59.83 18.32 124 20 CYS A 21 ? ? -179.17 109.35 125 20 THR A 34 ? ? -122.95 -60.82 #