data_2LCS # _entry.id 2LCS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LCS pdb_00002lcs 10.2210/pdb2lcs/pdb RCSB RCSB102238 ? ? BMRB 17629 ? 10.13018/BMR17629 WWPDB D_1000102238 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-02-01 2 'Structure model' 1 1 2012-04-11 3 'Structure model' 1 2 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_nmr_software 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LCS _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-05-07 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_id 17629 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gorelik, M.' 1 'Davidson, A.R.' 2 # _citation.id primary _citation.title ;Distinct Peptide Binding Specificities of Src Homology 3 (SH3) Protein Domains Can Be Determined by Modulation of Local Energetics across the Binding Interface. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 287 _citation.page_first 9168 _citation.page_last 9177 _citation.year 2012 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22277653 _citation.pdbx_database_id_DOI 10.1074/jbc.M111.330753 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gorelik, M.' 1 ? primary 'Davidson, A.R.' 2 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'NAP1-binding protein 2' 8391.204 1 ? ? 'SH3 domain residues 110-172' ? 2 polymer syn 'Serine/threonine-protein kinase STE20' 1639.915 1 2.7.11.1 ? 'sequence database residues 468-483' ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no MAIVNQRAVALYDFEPENDNELRLAEGDIVFISYKHGQGWLVAENESGSKTGLVPEEFVSYIQPELEHHHHHH MAIVNQRAVALYDFEPENDNELRLAEGDIVFISYKHGQGWLVAENESGSKTGLVPEEFVSYIQPELEHHHHHH A ? 2 'polypeptide(L)' no no GKFIPSRPAPKPPSSA GKFIPSRPAPKPPSSA B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ILE n 1 4 VAL n 1 5 ASN n 1 6 GLN n 1 7 ARG n 1 8 ALA n 1 9 VAL n 1 10 ALA n 1 11 LEU n 1 12 TYR n 1 13 ASP n 1 14 PHE n 1 15 GLU n 1 16 PRO n 1 17 GLU n 1 18 ASN n 1 19 ASP n 1 20 ASN n 1 21 GLU n 1 22 LEU n 1 23 ARG n 1 24 LEU n 1 25 ALA n 1 26 GLU n 1 27 GLY n 1 28 ASP n 1 29 ILE n 1 30 VAL n 1 31 PHE n 1 32 ILE n 1 33 SER n 1 34 TYR n 1 35 LYS n 1 36 HIS n 1 37 GLY n 1 38 GLN n 1 39 GLY n 1 40 TRP n 1 41 LEU n 1 42 VAL n 1 43 ALA n 1 44 GLU n 1 45 ASN n 1 46 GLU n 1 47 SER n 1 48 GLY n 1 49 SER n 1 50 LYS n 1 51 THR n 1 52 GLY n 1 53 LEU n 1 54 VAL n 1 55 PRO n 1 56 GLU n 1 57 GLU n 1 58 PHE n 1 59 VAL n 1 60 SER n 1 61 TYR n 1 62 ILE n 1 63 GLN n 1 64 PRO n 1 65 GLU n 1 66 LEU n 1 67 GLU n 1 68 HIS n 1 69 HIS n 1 70 HIS n 1 71 HIS n 1 72 HIS n 1 73 HIS n 2 1 GLY n 2 2 LYS n 2 3 PHE n 2 4 ILE n 2 5 PRO n 2 6 SER n 2 7 ARG n 2 8 PRO n 2 9 ALA n 2 10 PRO n 2 11 LYS n 2 12 PRO n 2 13 PRO n 2 14 SER n 2 15 SER n 2 16 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;Baker's yeast ; _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'NBP2, YDR162C' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 204508 / S288c' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 559292 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET21 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Saccharomyces cerevisiae S288c' _pdbx_entity_src_syn.organism_common_name ;Baker's yeast ; _pdbx_entity_src_syn.ncbi_taxonomy_id 559292 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -4 -4 MET MET A . n A 1 2 ALA 2 -3 -3 ALA ALA A . n A 1 3 ILE 3 -2 -2 ILE ILE A . n A 1 4 VAL 4 -1 -1 VAL VAL A . n A 1 5 ASN 5 1 1 ASN ASN A . n A 1 6 GLN 6 2 2 GLN GLN A . n A 1 7 ARG 7 3 3 ARG ARG A . n A 1 8 ALA 8 4 4 ALA ALA A . n A 1 9 VAL 9 5 5 VAL VAL A . n A 1 10 ALA 10 6 6 ALA ALA A . n A 1 11 LEU 11 7 7 LEU LEU A . n A 1 12 TYR 12 8 8 TYR TYR A . n A 1 13 ASP 13 9 9 ASP ASP A . n A 1 14 PHE 14 10 10 PHE PHE A . n A 1 15 GLU 15 11 11 GLU GLU A . n A 1 16 PRO 16 12 12 PRO PRO A . n A 1 17 GLU 17 13 13 GLU GLU A . n A 1 18 ASN 18 14 14 ASN ASN A . n A 1 19 ASP 19 15 15 ASP ASP A . n A 1 20 ASN 20 16 16 ASN ASN A . n A 1 21 GLU 21 17 17 GLU GLU A . n A 1 22 LEU 22 18 18 LEU LEU A . n A 1 23 ARG 23 19 19 ARG ARG A . n A 1 24 LEU 24 20 20 LEU LEU A . n A 1 25 ALA 25 21 21 ALA ALA A . n A 1 26 GLU 26 22 22 GLU GLU A . n A 1 27 GLY 27 23 23 GLY GLY A . n A 1 28 ASP 28 24 24 ASP ASP A . n A 1 29 ILE 29 25 25 ILE ILE A . n A 1 30 VAL 30 26 26 VAL VAL A . n A 1 31 PHE 31 27 27 PHE PHE A . n A 1 32 ILE 32 28 28 ILE ILE A . n A 1 33 SER 33 29 29 SER SER A . n A 1 34 TYR 34 30 30 TYR TYR A . n A 1 35 LYS 35 31 31 LYS LYS A . n A 1 36 HIS 36 32 32 HIS HIS A . n A 1 37 GLY 37 33 33 GLY GLY A . n A 1 38 GLN 38 34 34 GLN GLN A . n A 1 39 GLY 39 35 35 GLY GLY A . n A 1 40 TRP 40 36 36 TRP TRP A . n A 1 41 LEU 41 37 37 LEU LEU A . n A 1 42 VAL 42 38 38 VAL VAL A . n A 1 43 ALA 43 39 39 ALA ALA A . n A 1 44 GLU 44 40 40 GLU GLU A . n A 1 45 ASN 45 41 41 ASN ASN A . n A 1 46 GLU 46 42 42 GLU GLU A . n A 1 47 SER 47 43 43 SER SER A . n A 1 48 GLY 48 44 44 GLY GLY A . n A 1 49 SER 49 45 45 SER SER A . n A 1 50 LYS 50 46 46 LYS LYS A . n A 1 51 THR 51 47 47 THR THR A . n A 1 52 GLY 52 48 48 GLY GLY A . n A 1 53 LEU 53 49 49 LEU LEU A . n A 1 54 VAL 54 50 50 VAL VAL A . n A 1 55 PRO 55 51 51 PRO PRO A . n A 1 56 GLU 56 52 52 GLU GLU A . n A 1 57 GLU 57 53 53 GLU GLU A . n A 1 58 PHE 58 54 54 PHE PHE A . n A 1 59 VAL 59 55 55 VAL VAL A . n A 1 60 SER 60 56 56 SER SER A . n A 1 61 TYR 61 57 57 TYR TYR A . n A 1 62 ILE 62 58 58 ILE ILE A . n A 1 63 GLN 63 59 59 GLN GLN A . n A 1 64 PRO 64 60 60 PRO PRO A . n A 1 65 GLU 65 61 61 GLU GLU A . n A 1 66 LEU 66 62 62 LEU LEU A . n A 1 67 GLU 67 63 63 GLU GLU A . n A 1 68 HIS 68 64 ? ? ? A . n A 1 69 HIS 69 65 ? ? ? A . n A 1 70 HIS 70 66 ? ? ? A . n A 1 71 HIS 71 67 ? ? ? A . n A 1 72 HIS 72 68 ? ? ? A . n A 1 73 HIS 73 69 ? ? ? A . n B 2 1 GLY 1 -9 -9 GLY GLY B . n B 2 2 LYS 2 -8 -8 LYS LYS B . n B 2 3 PHE 3 -7 -7 PHE PHE B . n B 2 4 ILE 4 -6 -6 ILE ILE B . n B 2 5 PRO 5 -5 -5 PRO PRO B . n B 2 6 SER 6 -4 -4 SER SER B . n B 2 7 ARG 7 -3 -3 ARG ARG B . n B 2 8 PRO 8 -2 -2 PRO PRO B . n B 2 9 ALA 9 -1 -1 ALA ALA B . n B 2 10 PRO 10 0 0 PRO PRO B . n B 2 11 LYS 11 1 1 LYS LYS B . n B 2 12 PRO 12 2 2 PRO PRO B . n B 2 13 PRO 13 3 3 PRO PRO B . n B 2 14 SER 14 4 4 SER SER B . n B 2 15 SER 15 5 5 SER SER B . n B 2 16 ALA 16 6 6 ALA ALA B . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LCS _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LCS _struct.title 'Yeast Nbp2p SH3 domain in complex with a peptide from Ste20p' _struct.pdbx_model_details 'fewest violations, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LCS _struct_keywords.pdbx_keywords 'TRANSFERASE, signaling protein' _struct_keywords.text 'adaptor, TRANSFERASE, signaling protein' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP NBP2_YEAST Q12163 1 IVNQRAVALYDFEPENDNELRLAEGDIVFISYKHGQGWLVAENESGSKTGLVPEEFVSYIQPE 110 ? 2 UNP STE20_YEAST Q03497 2 GKFIPSRPAPKPPSSA 468 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2LCS A 3 ? 65 ? Q12163 110 ? 172 ? -2 61 2 2 2LCS B 1 ? 16 ? Q03497 468 ? 483 ? -9 6 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LCS MET A 1 ? UNP Q12163 ? ? 'expression tag' -4 1 1 2LCS ALA A 2 ? UNP Q12163 ? ? 'expression tag' -3 2 1 2LCS LEU A 66 ? UNP Q12163 ? ? 'expression tag' 62 3 1 2LCS GLU A 67 ? UNP Q12163 ? ? 'expression tag' 63 4 1 2LCS HIS A 68 ? UNP Q12163 ? ? 'expression tag' 64 5 1 2LCS HIS A 69 ? UNP Q12163 ? ? 'expression tag' 65 6 1 2LCS HIS A 70 ? UNP Q12163 ? ? 'expression tag' 66 7 1 2LCS HIS A 71 ? UNP Q12163 ? ? 'expression tag' 67 8 1 2LCS HIS A 72 ? UNP Q12163 ? ? 'expression tag' 68 9 1 2LCS HIS A 73 ? UNP Q12163 ? ? 'expression tag' 69 10 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 51 ? PRO A 55 ? THR A 47 PRO A 51 A 2 TRP A 40 ? GLU A 44 ? TRP A 36 GLU A 40 A 3 ILE A 29 ? HIS A 36 ? ILE A 25 HIS A 32 A 4 GLN A 6 ? ALA A 10 ? GLN A 2 ALA A 6 A 5 VAL A 59 ? TYR A 61 ? VAL A 55 TYR A 57 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 54 ? O VAL A 50 N LEU A 41 ? N LEU A 37 A 2 3 O GLU A 44 ? O GLU A 40 N PHE A 31 ? N PHE A 27 A 3 4 O VAL A 30 ? O VAL A 26 N ALA A 8 ? N ALA A 4 A 4 5 N VAL A 9 ? N VAL A 5 O SER A 60 ? O SER A 56 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 30 ? ? -173.86 149.27 2 1 GLU A 61 ? ? -156.57 25.18 3 1 ILE B -6 ? ? -153.21 84.13 4 1 PRO B 3 ? ? -69.78 -170.02 5 2 TYR A 30 ? ? -174.67 148.60 6 2 GLU A 61 ? ? -151.27 23.56 7 2 LYS B -8 ? ? -113.73 79.45 8 3 ALA A -3 ? ? -107.14 63.73 9 3 TYR A 30 ? ? -174.16 148.06 10 3 ASN A 41 ? ? -66.32 -174.77 11 3 GLU A 61 ? ? -158.65 26.90 12 3 ILE B -6 ? ? -152.98 88.28 13 3 PRO B 0 ? ? -69.73 -169.24 14 4 ASN A 1 ? ? -93.59 59.45 15 4 TYR A 30 ? ? -174.58 149.24 16 4 GLU A 61 ? ? -150.78 22.23 17 4 PRO B 0 ? ? -69.79 -177.94 18 4 PRO B 3 ? ? -69.72 -178.48 19 5 TYR A 30 ? ? -174.00 147.19 20 5 GLU A 61 ? ? -153.57 25.78 21 5 ILE B -6 ? ? -153.36 85.36 22 5 PRO B 0 ? ? -69.78 -177.35 23 6 TYR A 30 ? ? -174.37 146.74 24 6 ASN A 41 ? ? -67.57 -175.19 25 6 GLU A 61 ? ? -152.64 25.26 26 6 ILE B -6 ? ? -163.66 88.12 27 6 PRO B 3 ? ? -69.79 -171.87 28 7 ASN A 16 ? ? -140.92 13.68 29 7 TYR A 30 ? ? -174.32 147.52 30 7 ASN A 41 ? ? -67.94 -175.05 31 7 GLU A 61 ? ? -153.54 22.15 32 7 PRO B 0 ? ? -69.76 -170.55 33 8 TYR A 30 ? ? -174.27 149.87 34 8 GLU A 61 ? ? -154.27 25.01 35 8 ILE B -6 ? ? -155.47 84.87 36 8 PRO B 0 ? ? -69.76 -176.24 37 9 ASN A 1 ? ? 61.72 60.96 38 9 ASN A 16 ? ? -141.16 12.51 39 9 GLU A 61 ? ? -153.03 24.23 40 9 SER B -4 ? ? -117.18 59.95 41 10 ALA A -3 ? ? -97.64 54.83 42 10 ASN A 1 ? ? 60.02 60.32 43 10 TYR A 30 ? ? -174.10 146.79 44 10 ASN A 41 ? ? -58.57 -174.82 45 10 GLU A 61 ? ? -153.93 26.14 46 11 ASN A 16 ? ? -142.35 13.44 47 11 TYR A 30 ? ? -174.75 147.34 48 11 ASN A 41 ? ? -58.16 -175.08 49 11 GLU A 61 ? ? -161.39 39.02 50 11 ILE B -6 ? ? -173.52 90.05 51 11 ARG B -3 ? ? 179.87 155.34 52 11 PRO B 3 ? ? -69.78 -171.81 53 12 ASN A 41 ? ? -66.45 -175.35 54 12 GLU A 61 ? ? -157.09 36.41 55 12 SER B -4 ? ? -147.43 46.14 56 12 PRO B 0 ? ? -69.78 -174.74 57 12 PRO B 3 ? ? -69.71 80.74 58 13 ASN A 1 ? ? -94.14 59.83 59 13 ASN A 16 ? ? -140.31 15.37 60 13 TYR A 30 ? ? -174.68 148.58 61 13 ASN A 41 ? ? -68.60 -175.20 62 13 PRO A 60 ? ? -69.77 -86.58 63 13 ILE B -6 ? ? -153.36 85.19 64 13 PRO B 0 ? ? -69.73 -179.85 65 14 ALA A -3 ? ? -105.37 59.08 66 14 TYR A 30 ? ? -174.53 147.85 67 14 GLU A 61 ? ? -151.67 21.33 68 14 PRO B 0 ? ? -69.76 -170.24 69 14 PRO B 3 ? ? -69.70 -178.89 70 15 TYR A 30 ? ? -173.91 146.09 71 15 GLU A 61 ? ? -159.27 25.78 72 15 ILE B -6 ? ? -175.89 91.28 73 16 TYR A 30 ? ? -174.38 146.83 74 16 ASN A 41 ? ? -58.91 -174.80 75 16 GLU A 61 ? ? -161.73 35.31 76 16 PRO B 0 ? ? -69.78 -173.30 77 17 ASN A 16 ? ? -141.97 17.52 78 17 PRO A 60 ? ? -69.77 -84.13 79 17 GLU A 61 ? ? -140.30 39.68 80 17 PRO B 3 ? ? -69.73 -171.99 81 18 ASN A 1 ? ? -91.94 59.90 82 18 TYR A 30 ? ? -174.99 145.93 83 18 ASN A 41 ? ? -58.88 -174.88 84 18 PRO A 60 ? ? -69.75 -85.55 85 19 TYR A 30 ? ? -174.61 149.70 86 19 ASN A 41 ? ? -67.54 -175.06 87 19 PRO A 60 ? ? -69.78 -85.81 88 19 ILE B -6 ? ? -171.90 87.94 89 19 PRO B 3 ? ? -69.72 -170.69 90 20 TYR A 30 ? ? -174.61 149.11 91 20 PRO A 60 ? ? -69.79 -85.23 92 20 ILE B -6 ? ? -153.08 86.14 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LCS _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation 0.01 _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 1.42 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.20 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LCS _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.7 mM [U-99% 13C; U-99% 15N] Nbp2 SH3, 1.4 mM Ste20 peptide, 100 mM sodium chloride, 50 mM sodium phosphate, 0.05% % sodium azide, 95% H2O/5% D2O ; 1 '95% H2O/5% D2O' ;0.7 mM [U-99% 13C; U-99% 15N] Nbp2 SH3, 1.4 mM Ste20 peptide, 100 mM sodium chloride, 50 mM sodium phosphate, 0.05 % sodium azide, 100% D2O ; 2 '100% D2O' ;0.7 mM [U-99% 13C; U-99% 15N] Nbp2 SH3, 0.7 mM Ste20 peptide, 100 mM sodium chloride, 50 mM sodium phosphate, 0.05 % sodium azide, 95% H2O/5% D2O ; 3 '95% H2O/5% D2O' ;0.7 mM [U-99% 13C; U-99% 15N] Nbp2 SH3, 0.7 mM Ste20 peptide, 100 mM sodium chloride, 50 mM sodium phosphate, 0.05 % sodium azide, 100% D2O ; 4 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'Nbp2 SH3-1' 0.7 ? mM '[U-99% 13C; U-99% 15N]' 1 'Ste20 peptide-2' 1.4 ? mM ? 1 'sodium chloride-3' 100 ? mM ? 1 'sodium phosphate-4' 50 ? mM ? 1 'sodium azide-5' 0.05 ? % ? 1 'Nbp2 SH3-6' 0.7 ? mM '[U-99% 13C; U-99% 15N]' 2 'Ste20 peptide-7' 1.4 ? mM ? 2 'sodium chloride-8' 100 ? mM ? 2 'sodium phosphate-9' 50 ? mM ? 2 'sodium azide-10' 0.05 ? % ? 2 'Nbp2 SH3-11' 0.7 ? mM '[U-99% 13C; U-99% 15N]' 3 'Ste20 peptide-12' 0.7 ? mM ? 3 'sodium chloride-13' 100 ? mM ? 3 'sodium phosphate-14' 50 ? mM ? 3 'sodium azide-15' 0.05 ? % ? 3 'Nbp2 SH3-16' 0.7 ? mM '[U-99% 13C; U-99% 15N]' 4 'Ste20 peptide-17' 0.7 ? mM ? 4 'sodium chloride-18' 100 ? mM ? 4 'sodium phosphate-19' 50 ? mM ? 4 'sodium azide-20' 0.05 ? % ? 4 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D CBCA(CO)NH' 1 3 1 '3D HNCACB' 1 4 1 '3D HNCO' 1 5 1 '3D HN(CO)CA' 1 6 1 '3D C(CO)NH' 1 7 1 '3D H(CCO)NH' 1 8 2 '3D HCCH-COSY' 1 9 2 '3D 1H-15N NOESY' 1 10 2 '3D 1H-13C NOESY' 1 11 3 'N15 C13 filtered 2D 1H-1H TOCSY' 1 12 3 '15N C13 filtered 2D 1H-1H NOESY' 1 13 4 '13C half-filtered 3D 1H-13C NOESY' 1 14 4 '13C filtered 2D 1H-1H COSY' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LCS _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 2018 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 345 _pdbx_nmr_constraints.NOE_long_range_total_count 999 _pdbx_nmr_constraints.NOE_medium_range_total_count 257 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 417 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 44 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 43 # _pdbx_nmr_refine.entry_id 2LCS _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal Goddard 'peak picking' Sparky ? 1 Goddard 'chemical shift assignment' Sparky ? 2 'Guntert, Mumenthaler and Wuthrich' 'chemical shift assignment' CYANA ? 3 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 4 'Guntert, Mumenthaler and Wuthrich' 'data analysis' CYANA ? 5 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 6 'Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS ? 7 'Guntert, Mumenthaler and Wuthrich' refinement CYANA ? 8 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 64 ? A HIS 68 2 1 Y 1 A HIS 65 ? A HIS 69 3 1 Y 1 A HIS 66 ? A HIS 70 4 1 Y 1 A HIS 67 ? A HIS 71 5 1 Y 1 A HIS 68 ? A HIS 72 6 1 Y 1 A HIS 69 ? A HIS 73 7 2 Y 1 A HIS 64 ? A HIS 68 8 2 Y 1 A HIS 65 ? A HIS 69 9 2 Y 1 A HIS 66 ? A HIS 70 10 2 Y 1 A HIS 67 ? A HIS 71 11 2 Y 1 A HIS 68 ? A HIS 72 12 2 Y 1 A HIS 69 ? A HIS 73 13 3 Y 1 A HIS 64 ? A HIS 68 14 3 Y 1 A HIS 65 ? A HIS 69 15 3 Y 1 A HIS 66 ? A HIS 70 16 3 Y 1 A HIS 67 ? A HIS 71 17 3 Y 1 A HIS 68 ? A HIS 72 18 3 Y 1 A HIS 69 ? A HIS 73 19 4 Y 1 A HIS 64 ? A HIS 68 20 4 Y 1 A HIS 65 ? A HIS 69 21 4 Y 1 A HIS 66 ? A HIS 70 22 4 Y 1 A HIS 67 ? A HIS 71 23 4 Y 1 A HIS 68 ? A HIS 72 24 4 Y 1 A HIS 69 ? A HIS 73 25 5 Y 1 A HIS 64 ? A HIS 68 26 5 Y 1 A HIS 65 ? A HIS 69 27 5 Y 1 A HIS 66 ? A HIS 70 28 5 Y 1 A HIS 67 ? A HIS 71 29 5 Y 1 A HIS 68 ? A HIS 72 30 5 Y 1 A HIS 69 ? A HIS 73 31 6 Y 1 A HIS 64 ? A HIS 68 32 6 Y 1 A HIS 65 ? A HIS 69 33 6 Y 1 A HIS 66 ? A HIS 70 34 6 Y 1 A HIS 67 ? A HIS 71 35 6 Y 1 A HIS 68 ? A HIS 72 36 6 Y 1 A HIS 69 ? A HIS 73 37 7 Y 1 A HIS 64 ? A HIS 68 38 7 Y 1 A HIS 65 ? A HIS 69 39 7 Y 1 A HIS 66 ? A HIS 70 40 7 Y 1 A HIS 67 ? A HIS 71 41 7 Y 1 A HIS 68 ? A HIS 72 42 7 Y 1 A HIS 69 ? A HIS 73 43 8 Y 1 A HIS 64 ? A HIS 68 44 8 Y 1 A HIS 65 ? A HIS 69 45 8 Y 1 A HIS 66 ? A HIS 70 46 8 Y 1 A HIS 67 ? A HIS 71 47 8 Y 1 A HIS 68 ? A HIS 72 48 8 Y 1 A HIS 69 ? A HIS 73 49 9 Y 1 A HIS 64 ? A HIS 68 50 9 Y 1 A HIS 65 ? A HIS 69 51 9 Y 1 A HIS 66 ? A HIS 70 52 9 Y 1 A HIS 67 ? A HIS 71 53 9 Y 1 A HIS 68 ? A HIS 72 54 9 Y 1 A HIS 69 ? A HIS 73 55 10 Y 1 A HIS 64 ? A HIS 68 56 10 Y 1 A HIS 65 ? A HIS 69 57 10 Y 1 A HIS 66 ? A HIS 70 58 10 Y 1 A HIS 67 ? A HIS 71 59 10 Y 1 A HIS 68 ? A HIS 72 60 10 Y 1 A HIS 69 ? A HIS 73 61 11 Y 1 A HIS 64 ? A HIS 68 62 11 Y 1 A HIS 65 ? A HIS 69 63 11 Y 1 A HIS 66 ? A HIS 70 64 11 Y 1 A HIS 67 ? A HIS 71 65 11 Y 1 A HIS 68 ? A HIS 72 66 11 Y 1 A HIS 69 ? A HIS 73 67 12 Y 1 A HIS 64 ? A HIS 68 68 12 Y 1 A HIS 65 ? A HIS 69 69 12 Y 1 A HIS 66 ? A HIS 70 70 12 Y 1 A HIS 67 ? A HIS 71 71 12 Y 1 A HIS 68 ? A HIS 72 72 12 Y 1 A HIS 69 ? A HIS 73 73 13 Y 1 A HIS 64 ? A HIS 68 74 13 Y 1 A HIS 65 ? A HIS 69 75 13 Y 1 A HIS 66 ? A HIS 70 76 13 Y 1 A HIS 67 ? A HIS 71 77 13 Y 1 A HIS 68 ? A HIS 72 78 13 Y 1 A HIS 69 ? A HIS 73 79 14 Y 1 A HIS 64 ? A HIS 68 80 14 Y 1 A HIS 65 ? A HIS 69 81 14 Y 1 A HIS 66 ? A HIS 70 82 14 Y 1 A HIS 67 ? A HIS 71 83 14 Y 1 A HIS 68 ? A HIS 72 84 14 Y 1 A HIS 69 ? A HIS 73 85 15 Y 1 A HIS 64 ? A HIS 68 86 15 Y 1 A HIS 65 ? A HIS 69 87 15 Y 1 A HIS 66 ? A HIS 70 88 15 Y 1 A HIS 67 ? A HIS 71 89 15 Y 1 A HIS 68 ? A HIS 72 90 15 Y 1 A HIS 69 ? A HIS 73 91 16 Y 1 A HIS 64 ? A HIS 68 92 16 Y 1 A HIS 65 ? A HIS 69 93 16 Y 1 A HIS 66 ? A HIS 70 94 16 Y 1 A HIS 67 ? A HIS 71 95 16 Y 1 A HIS 68 ? A HIS 72 96 16 Y 1 A HIS 69 ? A HIS 73 97 17 Y 1 A HIS 64 ? A HIS 68 98 17 Y 1 A HIS 65 ? A HIS 69 99 17 Y 1 A HIS 66 ? A HIS 70 100 17 Y 1 A HIS 67 ? A HIS 71 101 17 Y 1 A HIS 68 ? A HIS 72 102 17 Y 1 A HIS 69 ? A HIS 73 103 18 Y 1 A HIS 64 ? A HIS 68 104 18 Y 1 A HIS 65 ? A HIS 69 105 18 Y 1 A HIS 66 ? A HIS 70 106 18 Y 1 A HIS 67 ? A HIS 71 107 18 Y 1 A HIS 68 ? A HIS 72 108 18 Y 1 A HIS 69 ? A HIS 73 109 19 Y 1 A HIS 64 ? A HIS 68 110 19 Y 1 A HIS 65 ? A HIS 69 111 19 Y 1 A HIS 66 ? A HIS 70 112 19 Y 1 A HIS 67 ? A HIS 71 113 19 Y 1 A HIS 68 ? A HIS 72 114 19 Y 1 A HIS 69 ? A HIS 73 115 20 Y 1 A HIS 64 ? A HIS 68 116 20 Y 1 A HIS 65 ? A HIS 69 117 20 Y 1 A HIS 66 ? A HIS 70 118 20 Y 1 A HIS 67 ? A HIS 71 119 20 Y 1 A HIS 68 ? A HIS 72 120 20 Y 1 A HIS 69 ? A HIS 73 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker INOVA 1 'Bruker INOVA' 800 Bruker INOVA 2 'Bruker INOVA' # _atom_sites.entry_id 2LCS _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_