data_2LIQ # _entry.id 2LIQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.348 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LIQ pdb_00002liq 10.2210/pdb2liq/pdb RCSB RCSB102432 ? ? BMRB 17902 ? ? WWPDB D_1000102432 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 2LIE PDB unspecified . 17902 BMRB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LIQ _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-08-30 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Schubert, M.' 1 'Bleuler-Martinez, S.' 2 'Walti, M.A.' 3 'Egloff, P.' 4 'Aebi, M.' 5 'Kuenzler, M.' 6 'Allain, F.H.-T.' 7 # _citation.id primary _citation.title ;Plasticity of the beta-Trefoil Protein Fold in the Recognition and Control of Invertebrate Predators and Parasites by a Fungal Defence System ; _citation.journal_abbrev 'Plos Pathog.' _citation.journal_volume 8 _citation.page_first e1002706 _citation.page_last e1002706 _citation.year 2012 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1553-7366 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22615566 _citation.pdbx_database_id_DOI 10.1371/journal.ppat.1002706 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Schubert, M.' 1 ? primary 'Bleuler-Martinez, S.' 2 ? primary 'Butschi, A.' 3 ? primary 'Walti, M.A.' 4 ? primary 'Egloff, P.' 5 ? primary 'Stutz, K.' 6 ? primary 'Yan, S.' 7 ? primary 'Wilson, I.B.' 8 ? primary 'Hengartner, M.O.' 9 ? primary 'Aebi, M.' 10 ? primary 'Allain, F.H.' 11 ? primary 'Kunzler, M.' 12 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CCL2 lectin' 16604.281 1 ? ? ? ? 2 branched man 'alpha-L-fucopyranose-(1-3)-[2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)]methyl 2-acetamido-2-deoxy-beta-D-glucopyranoside' 584.568 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGHHHHHHHHSGDSPAVTLSAGNYIIYNRVLSPRGEKLALTYPGRQRTPVTVSPLDGSSEQAWILRSYDSNSNTWTISPV GSPNSQIGWGAGNVPVVLPPNNYVWTLTLTSGGYNIQDGKRTVSWSLNNATAGEEVSIGADATFSGRWVIEKV ; _entity_poly.pdbx_seq_one_letter_code_can ;MGHHHHHHHHSGDSPAVTLSAGNYIIYNRVLSPRGEKLALTYPGRQRTPVTVSPLDGSSEQAWILRSYDSNSNTWTISPV GSPNSQIGWGAGNVPVVLPPNNYVWTLTLTSGGYNIQDGKRTVSWSLNNATAGEEVSIGADATFSGRWVIEKV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 GLY n 1 13 ASP n 1 14 SER n 1 15 PRO n 1 16 ALA n 1 17 VAL n 1 18 THR n 1 19 LEU n 1 20 SER n 1 21 ALA n 1 22 GLY n 1 23 ASN n 1 24 TYR n 1 25 ILE n 1 26 ILE n 1 27 TYR n 1 28 ASN n 1 29 ARG n 1 30 VAL n 1 31 LEU n 1 32 SER n 1 33 PRO n 1 34 ARG n 1 35 GLY n 1 36 GLU n 1 37 LYS n 1 38 LEU n 1 39 ALA n 1 40 LEU n 1 41 THR n 1 42 TYR n 1 43 PRO n 1 44 GLY n 1 45 ARG n 1 46 GLN n 1 47 ARG n 1 48 THR n 1 49 PRO n 1 50 VAL n 1 51 THR n 1 52 VAL n 1 53 SER n 1 54 PRO n 1 55 LEU n 1 56 ASP n 1 57 GLY n 1 58 SER n 1 59 SER n 1 60 GLU n 1 61 GLN n 1 62 ALA n 1 63 TRP n 1 64 ILE n 1 65 LEU n 1 66 ARG n 1 67 SER n 1 68 TYR n 1 69 ASP n 1 70 SER n 1 71 ASN n 1 72 SER n 1 73 ASN n 1 74 THR n 1 75 TRP n 1 76 THR n 1 77 ILE n 1 78 SER n 1 79 PRO n 1 80 VAL n 1 81 GLY n 1 82 SER n 1 83 PRO n 1 84 ASN n 1 85 SER n 1 86 GLN n 1 87 ILE n 1 88 GLY n 1 89 TRP n 1 90 GLY n 1 91 ALA n 1 92 GLY n 1 93 ASN n 1 94 VAL n 1 95 PRO n 1 96 VAL n 1 97 VAL n 1 98 LEU n 1 99 PRO n 1 100 PRO n 1 101 ASN n 1 102 ASN n 1 103 TYR n 1 104 VAL n 1 105 TRP n 1 106 THR n 1 107 LEU n 1 108 THR n 1 109 LEU n 1 110 THR n 1 111 SER n 1 112 GLY n 1 113 GLY n 1 114 TYR n 1 115 ASN n 1 116 ILE n 1 117 GLN n 1 118 ASP n 1 119 GLY n 1 120 LYS n 1 121 ARG n 1 122 THR n 1 123 VAL n 1 124 SER n 1 125 TRP n 1 126 SER n 1 127 LEU n 1 128 ASN n 1 129 ASN n 1 130 ALA n 1 131 THR n 1 132 ALA n 1 133 GLY n 1 134 GLU n 1 135 GLU n 1 136 VAL n 1 137 SER n 1 138 ILE n 1 139 GLY n 1 140 ALA n 1 141 ASP n 1 142 ALA n 1 143 THR n 1 144 PHE n 1 145 SER n 1 146 GLY n 1 147 ARG n 1 148 TRP n 1 149 VAL n 1 150 ILE n 1 151 GLU n 1 152 LYS n 1 153 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Inky cap fungus' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ccl2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Coprinopsis cinerea' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5346 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET22 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B3GA02_COPCI _struct_ref.pdbx_db_accession B3GA02 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DSPAVTLSAGNYIIYNRVLSPRGEKLALTYPGRQRTPVTVSPLDGSSEQAWILRSYDSNSNTWTISPVGSPNSQIGWGAG NVPVVLPPNNYVWTLTLTSGGYNIQDGKRTVSWSLNNATAGEEVSIGADATFSGRWVIEKV ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LIQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 13 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 153 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B3GA02 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 142 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 13 _struct_ref_seq.pdbx_auth_seq_align_end 153 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LIQ MET A 1 ? UNP B3GA02 ? ? 'expression tag' 1 1 1 2LIQ GLY A 2 ? UNP B3GA02 ? ? 'expression tag' 2 2 1 2LIQ HIS A 3 ? UNP B3GA02 ? ? 'expression tag' 3 3 1 2LIQ HIS A 4 ? UNP B3GA02 ? ? 'expression tag' 4 4 1 2LIQ HIS A 5 ? UNP B3GA02 ? ? 'expression tag' 5 5 1 2LIQ HIS A 6 ? UNP B3GA02 ? ? 'expression tag' 6 6 1 2LIQ HIS A 7 ? UNP B3GA02 ? ? 'expression tag' 7 7 1 2LIQ HIS A 8 ? UNP B3GA02 ? ? 'expression tag' 8 8 1 2LIQ HIS A 9 ? UNP B3GA02 ? ? 'expression tag' 9 9 1 2LIQ HIS A 10 ? UNP B3GA02 ? ? 'expression tag' 10 10 1 2LIQ SER A 11 ? UNP B3GA02 ? ? 'expression tag' 11 11 1 2LIQ GLY A 12 ? UNP B3GA02 ? ? 'expression tag' 12 12 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose 'alpha-L-fucose; 6-deoxy-alpha-L-galactopyranose; L-fucose; fucose' 'C6 H12 O5' 164.156 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MAG D-saccharide n 'methyl 2-acetamido-2-deoxy-beta-D-glucopyranoside' ;BETA-METHYL-N-ACETYL-D-GLUCOSAMINE; methyl 2-acetamido-2-deoxy-beta-D-glucoside; methyl 2-acetamido-2-deoxy-D-glucoside; methyl 2-acetamido-2-deoxy-glucoside ; 'C9 H17 N O6' 235.234 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 15N-HSQC' 1 3 1 '2D NOESY' 1 4 1 '3D 15N edited NOESY' 1 5 1 '2D 15N F1-filtered,F2-filtered NOESY' 1 6 2 '2D NOESY' 1 7 2 '2D TOCSY' 1 8 2 '2D 13C-HSQC (at natural abundance)' 1 9 2 '2D 15N-HSQC (for H/D exchange)' 1 10 3 '2D 13C-HSQC for aliphatic region' 1 11 3 '2D 13C-HSQC for aromatic region' 1 12 3 '3D 13Cedited-NOESY for aliphatic region' 1 13 3 '2D 13Cedited NOESY for aromatic region' 1 14 3 '3D HNCA' 1 15 3 '3D HNCACB' 1 16 3 '3D HNCO' 1 17 4 '2D 13C-HSQC for aliphatic region' 1 18 4 '2D 13C-HSQC for aromatic region' 1 19 4 '3D HCCH-COSY' 1 20 4 '2D 13C F1-filtered TOCSY' 1 21 4 '2D 13C F1-filtered NOESY' 1 22 4 '2D 13C F1-filtered, F2-filtered NOESY' 1 23 4 '3D 13C F1-edited, F3-filtered NOESY for aliphatic region' 1 24 4 '3D 13C F1-edited, F3-filtered NOESY for aromatic region' 1 25 5 '2D constant-time 13C-HSQC to unambiguously assign the stereochemical methyl groups of VAL and LEU' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.pH 4.7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.temperature_units K _pdbx_nmr_exptl_sample_conditions.label ? _pdbx_nmr_exptl_sample_conditions.pH_units ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details ;1 mM [U-100% 13C; U-100% 15N] CCL2, 1 mM SUGAR (3-MER), 50 mM potassium phosphate, 100 mM sodium chloride, ~41 mM [U-100% 2H] acetic acid, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' sample_1 solution ? ;1 mM [U-100% 13C; U-100% 15N] CCL2, 1 mM SUGAR (3-MER), 50 mM potassium phosphate, 100 mM sodium chloride, ~41 mM [U-100% 2H] acetic acid, 100% D2O ; 2 '100% D2O' sample_2 solution ? ;1 mM [U-100% 15N] CCL2, 1 mM SUGAR (3-MER), 50 mM potassium phosphate, 100 mM sodium chloride, ~41 mM [U-100% 2H] acetic acid, 90% H2O/10% D2O ; 3 '90% H2O/10% D2O' sample_3 solution ? ;1 mM [U-100% 15N] CCL2, 1 mM SUGAR (3-MER), 50 mM potassium phosphate, 100 mM sodium chloride, ~41 mM [U-100% 2H] acetic acid, 100% D2O ; 4 '100% D2O' sample_4 solution ? ;1 mM [U-1% 13C; U-100% 15N] CCL2, 1 mM SUGAR (3-MER), 50 mM potassium phosphate, 100 mM sodium chloride, 41 mM [U-100% 2H] acetic acid 95%H2O/5% D2O ; 5 '95% H2O/5% D2O' sample_5 solution ? # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker AVANCE 1 'Bruker Avance' 600 Bruker AVANCE 2 'Bruker Avance' 750 Bruker AVANCE 3 'Bruker Avance' 900 Bruker AVANCE 4 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2LIQ _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 7 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 300 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LIQ _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LIQ _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin ? 1 'Bruker Biospin' processing TopSpin ? 2 Goddard 'data analysis' Sparky ? 3 Goddard 'chemical shift assignment' Sparky ? 4 'Herrmann, Guntert and Wuthrich' 'structure solution' CYANA ? 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 6 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, and Kollman' refinement Amber ? 7 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS ? 8 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LIQ _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LIQ _struct.title 'Solution structure of CCL2 in complex with glycan' _struct.pdbx_model_details 'closest to the average, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LIQ _struct_keywords.pdbx_keywords 'SUGAR BINDING PROTEIN' _struct_keywords.text 'carbohydrate recognition, SUGAR BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B MAG . O3 ? ? ? 1_555 B FUC . C1 ? ? B MAG 1 B FUC 2 1_555 ? ? ? ? ? ? ? 1.473 ? ? covale2 covale both ? B MAG . O4 ? ? ? 1_555 B NAG . C1 ? ? B MAG 1 B NAG 3 1_555 ? ? ? ? ? ? ? 1.468 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 7 ? B ? 2 ? C ? 2 ? D ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel D 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 22 ? ASN A 28 ? GLY A 22 ASN A 28 A 2 TRP A 63 ? SER A 67 ? TRP A 63 SER A 67 A 3 THR A 74 ? PRO A 79 ? THR A 74 PRO A 79 A 4 TRP A 105 ? THR A 110 ? TRP A 105 THR A 110 A 5 GLY A 113 ? GLN A 117 ? GLY A 113 GLN A 117 A 6 TRP A 148 ? LYS A 152 ? TRP A 148 LYS A 152 A 7 GLY A 22 ? ASN A 28 ? GLY A 22 ASN A 28 B 1 LEU A 38 ? THR A 41 ? LEU A 38 THR A 41 B 2 THR A 51 ? PRO A 54 ? THR A 51 PRO A 54 C 1 GLN A 86 ? TRP A 89 ? GLN A 86 TRP A 89 C 2 PRO A 95 ? LEU A 98 ? PRO A 95 LEU A 98 D 1 SER A 124 ? SER A 126 ? SER A 124 SER A 126 D 2 SER A 137 ? GLY A 139 ? SER A 137 GLY A 139 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 24 ? N TYR A 24 O TRP A 63 ? O TRP A 63 A 2 3 N ARG A 66 ? N ARG A 66 O THR A 76 ? O THR A 76 A 3 4 N TRP A 75 ? N TRP A 75 O TRP A 105 ? O TRP A 105 A 4 5 N THR A 106 ? N THR A 106 O GLN A 117 ? O GLN A 117 A 5 6 N TYR A 114 ? N TYR A 114 O TRP A 148 ? O TRP A 148 A 6 7 O GLU A 151 ? O GLU A 151 N ILE A 25 ? N ILE A 25 B 1 2 N THR A 41 ? N THR A 41 O THR A 51 ? O THR A 51 C 1 2 N GLN A 86 ? N GLN A 86 O LEU A 98 ? O LEU A 98 D 1 2 N SER A 124 ? N SER A 124 O GLY A 139 ? O GLY A 139 # _atom_sites.entry_id 2LIQ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 TRP 63 63 63 TRP TRP A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 TRP 75 75 75 TRP TRP A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 TRP 89 89 89 TRP TRP A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 ASN 93 93 93 ASN ASN A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 PRO 99 99 99 PRO PRO A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 ASN 102 102 102 ASN ASN A . n A 1 103 TYR 103 103 103 TYR TYR A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 TRP 105 105 105 TRP TRP A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 TYR 114 114 114 TYR TYR A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 GLN 117 117 117 GLN GLN A . n A 1 118 ASP 118 118 118 ASP ASP A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 ARG 121 121 121 ARG ARG A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 SER 124 124 124 SER SER A . n A 1 125 TRP 125 125 125 TRP TRP A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 ASN 128 128 128 ASN ASN A . n A 1 129 ASN 129 129 129 ASN ASN A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 SER 137 137 137 SER SER A . n A 1 138 ILE 138 138 138 ILE ILE A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 PHE 144 144 144 PHE PHE A . n A 1 145 SER 145 145 145 SER SER A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 TRP 148 148 148 TRP TRP A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 VAL 153 153 153 VAL VAL A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-06-06 2 'Structure model' 1 1 2017-11-15 3 'Structure model' 2 0 2020-07-29 4 'Structure model' 2 1 2021-08-18 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 3 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Atomic model' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Derived calculations' 6 3 'Structure model' 'Structure summary' 7 4 'Structure model' 'Data collection' 8 4 'Structure model' 'Database references' 9 4 'Structure model' 'Experimental preparation' 10 4 'Structure model' 'Refinement description' 11 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_database_related 2 3 'Structure model' atom_site 3 3 'Structure model' chem_comp 4 3 'Structure model' entity 5 3 'Structure model' pdbx_branch_scheme 6 3 'Structure model' pdbx_chem_comp_identifier 7 3 'Structure model' pdbx_entity_branch 8 3 'Structure model' pdbx_entity_branch_descriptor 9 3 'Structure model' pdbx_entity_branch_link 10 3 'Structure model' pdbx_entity_branch_list 11 3 'Structure model' pdbx_entity_nonpoly 12 3 'Structure model' pdbx_nmr_software 13 3 'Structure model' pdbx_nmr_spectrometer 14 3 'Structure model' pdbx_nonpoly_scheme 15 3 'Structure model' pdbx_struct_assembly_gen 16 3 'Structure model' struct_asym 17 3 'Structure model' struct_conn 18 3 'Structure model' struct_ref_seq_dif 19 3 'Structure model' struct_site 20 3 'Structure model' struct_site_gen 21 4 'Structure model' chem_comp 22 4 'Structure model' database_2 23 4 'Structure model' pdbx_nmr_exptl_sample 24 4 'Structure model' pdbx_nmr_refine 25 4 'Structure model' pdbx_nmr_sample_details 26 4 'Structure model' pdbx_nmr_software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_atom_site.Cartn_x' 2 3 'Structure model' '_atom_site.Cartn_y' 3 3 'Structure model' '_atom_site.Cartn_z' 4 3 'Structure model' '_atom_site.auth_asym_id' 5 3 'Structure model' '_atom_site.auth_atom_id' 6 3 'Structure model' '_atom_site.auth_comp_id' 7 3 'Structure model' '_atom_site.auth_seq_id' 8 3 'Structure model' '_atom_site.label_asym_id' 9 3 'Structure model' '_atom_site.label_atom_id' 10 3 'Structure model' '_atom_site.label_comp_id' 11 3 'Structure model' '_atom_site.label_entity_id' 12 3 'Structure model' '_atom_site.type_symbol' 13 3 'Structure model' '_chem_comp.mon_nstd_flag' 14 3 'Structure model' '_chem_comp.name' 15 3 'Structure model' '_chem_comp.type' 16 3 'Structure model' '_pdbx_nmr_software.name' 17 3 'Structure model' '_pdbx_nmr_spectrometer.model' 18 3 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 19 3 'Structure model' '_struct_conn.pdbx_dist_value' 20 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 21 3 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 22 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 23 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 24 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 25 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 26 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 27 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 28 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 29 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 30 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 31 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 32 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 33 3 'Structure model' '_struct_ref_seq_dif.details' 34 4 'Structure model' '_chem_comp.pdbx_synonyms' 35 4 'Structure model' '_database_2.pdbx_DOI' 36 4 'Structure model' '_database_2.pdbx_database_accession' 37 4 'Structure model' '_pdbx_nmr_refine.software_ordinal' 38 4 'Structure model' '_pdbx_nmr_sample_details.contents' 39 4 'Structure model' '_pdbx_nmr_sample_details.label' 40 4 'Structure model' '_pdbx_nmr_sample_details.type' 41 4 'Structure model' '_pdbx_nmr_software.authors' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id CCL2-1 1 ? mM '[U-100% 13C; U-100% 15N]' 1 'SUGAR (3-MER)-2' 1 ? mM ? 1 'potassium phosphate-3' 50 ? mM ? 1 'sodium chloride-4' 100 ? mM ? 1 'acetic acid-5' 41 ? mM '[U-100% 2H]' 1 CCL2-6 1 ? mM '[U-100% 13C; U-100% 15N]' 2 'SUGAR (3-MER)-7' 1 ? mM ? 2 'potassium phosphate-8' 50 ? mM ? 2 'sodium chloride-9' 100 ? mM ? 2 'acetic acid-10' 41 ? mM '[U-100% 2H]' 2 CCL2-11 1 ? mM '[U-100% 15N]' 3 'SUGAR (3-MER)-12' 1 ? mM ? 3 'potassium phosphate-13' 50 ? mM ? 3 'sodium chloride-14' 100 ? mM ? 3 'acetic acid-15' 41 ? mM '[U-100% 2H]' 3 CCL2-16 1 ? mM '[U-100% 15N]' 4 'SUGAR (3-MER)-17' 1 ? mM ? 4 'potassium phosphate-18' 50 ? mM ? 4 'sodium chloride-19' 100 ? mM ? 4 'acetic acid-20' 41 ? mM '[U-100% 2H]' 4 CCL2 1 ? mM '[U-1% 13C; U-100% 15N]' 5 'SUGAR (3-MER)' 1 ? mM 'natural abundance' 5 'potassium phosphate' 50 ? mM 'natural abundance' 5 'sodium chloride' 100 ? mM 'natural abundance' 5 'acetic acid' 41 ? mM '[U-100% 2H]' 5 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LIQ _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 98 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 2054 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 446 _pdbx_nmr_constraints.NOE_long_range_total_count 1119 _pdbx_nmr_constraints.NOE_medium_range_total_count ? _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 489 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 85 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 91 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 2 NE A ARG 121 ? ? CZ A ARG 121 ? ? NH1 A ARG 121 ? ? 123.61 120.30 3.31 0.50 N 2 4 NE A ARG 147 ? ? CZ A ARG 147 ? ? NH1 A ARG 147 ? ? 123.55 120.30 3.25 0.50 N 3 5 NE A ARG 121 ? ? CZ A ARG 121 ? ? NH1 A ARG 121 ? ? 123.59 120.30 3.29 0.50 N 4 14 NE A ARG 147 ? ? CZ A ARG 147 ? ? NH1 A ARG 147 ? ? 123.85 120.30 3.55 0.50 N 5 15 NE A ARG 121 ? ? CZ A ARG 121 ? ? NH1 A ARG 121 ? ? 123.60 120.30 3.30 0.50 N 6 16 NE A ARG 121 ? ? CZ A ARG 121 ? ? NH1 A ARG 121 ? ? 123.57 120.30 3.27 0.50 N 7 16 NE A ARG 147 ? ? CZ A ARG 147 ? ? NH1 A ARG 147 ? ? 123.52 120.30 3.22 0.50 N 8 17 NE A ARG 121 ? ? CZ A ARG 121 ? ? NH1 A ARG 121 ? ? 123.32 120.30 3.02 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 13 ? ? -142.92 -6.27 2 1 LEU A 31 ? ? 52.68 -144.55 3 1 SER A 82 ? ? -140.32 55.89 4 1 ALA A 91 ? ? 56.99 0.73 5 1 ASN A 101 ? ? -147.00 -78.52 6 1 ASN A 102 ? ? -152.81 14.88 7 1 SER A 111 ? ? -57.34 -6.84 8 1 ARG A 121 ? ? 54.14 18.43 9 2 HIS A 3 ? ? -142.88 21.40 10 2 PRO A 15 ? ? -49.43 154.17 11 2 ALA A 21 ? ? -67.85 93.58 12 2 LEU A 31 ? ? 54.40 -142.50 13 2 ASN A 84 ? ? -68.86 6.48 14 2 ALA A 91 ? ? 55.87 -1.57 15 2 ASN A 101 ? ? -147.89 -92.27 16 2 ASN A 102 ? ? -144.41 10.79 17 2 LEU A 107 ? ? -112.18 78.16 18 2 SER A 111 ? ? -59.61 -6.47 19 2 ARG A 121 ? ? 56.98 16.29 20 2 PHE A 144 ? ? -151.42 -27.21 21 3 HIS A 3 ? ? -142.82 10.78 22 3 ALA A 91 ? ? 56.06 -0.21 23 3 ASN A 101 ? ? -149.31 -82.89 24 3 ASN A 102 ? ? -149.09 11.55 25 4 ASP A 13 ? ? -145.68 25.48 26 4 LEU A 31 ? ? 52.48 -155.97 27 4 TYR A 68 ? ? -133.34 -38.16 28 4 SER A 82 ? ? -153.76 61.25 29 4 ALA A 91 ? ? 56.31 -0.31 30 4 PRO A 99 ? ? -48.69 155.09 31 4 ASN A 101 ? ? -151.27 -108.14 32 4 ASN A 102 ? ? -149.01 21.03 33 4 LEU A 107 ? ? -111.54 78.16 34 4 SER A 111 ? ? -59.81 -8.58 35 4 PHE A 144 ? ? -158.06 -24.40 36 5 HIS A 7 ? ? -147.40 -17.99 37 5 ASP A 13 ? ? -151.34 -25.83 38 5 ASP A 56 ? ? -144.69 -23.28 39 5 ALA A 91 ? ? 57.78 0.57 40 5 PRO A 99 ? ? -49.82 153.83 41 5 ASN A 101 ? ? -153.83 -100.44 42 5 ASN A 102 ? ? -153.26 24.35 43 5 PHE A 144 ? ? -155.56 -28.68 44 5 SER A 145 ? ? -63.66 5.46 45 6 HIS A 8 ? ? -140.10 19.18 46 6 ALA A 16 ? ? -141.30 -63.86 47 6 VAL A 17 ? ? -144.24 -63.75 48 6 THR A 18 ? ? -170.05 14.98 49 6 LEU A 31 ? ? 54.79 -136.98 50 6 SER A 82 ? ? -145.57 58.00 51 6 PRO A 99 ? ? -48.64 151.32 52 6 ASN A 101 ? ? -150.54 -87.72 53 6 ASN A 102 ? ? -157.11 22.31 54 6 SER A 111 ? ? -58.74 -4.04 55 6 VAL A 136 ? ? 59.61 169.71 56 7 HIS A 3 ? ? -140.22 -1.31 57 7 HIS A 9 ? ? 57.19 -170.86 58 7 ASP A 13 ? ? -144.40 -4.23 59 7 LEU A 31 ? ? 50.29 -153.39 60 7 ASN A 84 ? ? -67.20 0.40 61 7 ALA A 91 ? ? 57.72 2.10 62 7 ASN A 101 ? ? -163.48 -152.17 63 7 ARG A 121 ? ? 54.42 15.63 64 8 HIS A 8 ? ? 60.69 -8.70 65 8 HIS A 10 ? ? -146.70 -28.76 66 8 PRO A 33 ? ? -53.63 -8.99 67 8 TYR A 68 ? ? -130.02 -34.50 68 8 ASN A 84 ? ? -67.08 1.11 69 8 ALA A 91 ? ? 59.79 3.55 70 8 ASN A 101 ? ? -148.30 -86.59 71 8 ASN A 102 ? ? -147.98 10.54 72 8 SER A 111 ? ? -59.50 -8.46 73 9 LEU A 31 ? ? 50.08 -127.02 74 9 TYR A 68 ? ? -131.20 -39.36 75 9 SER A 82 ? ? -151.21 60.07 76 9 ASN A 101 ? ? -151.81 28.71 77 10 HIS A 4 ? ? -148.90 -2.53 78 10 ALA A 91 ? ? 56.76 0.45 79 10 ASN A 101 ? ? -148.67 35.10 80 10 ASN A 102 ? ? 39.14 52.32 81 10 SER A 111 ? ? -59.42 -3.96 82 11 HIS A 5 ? ? -153.30 -32.89 83 11 HIS A 6 ? ? -142.80 -1.79 84 11 HIS A 9 ? ? -142.52 13.00 85 11 VAL A 17 ? ? -142.90 -58.54 86 11 THR A 18 ? ? -169.44 18.49 87 11 ARG A 29 ? ? -65.31 3.23 88 11 LEU A 31 ? ? 54.70 -152.64 89 11 SER A 82 ? ? -143.25 58.90 90 11 ALA A 91 ? ? 56.85 0.35 91 11 ASN A 102 ? ? -65.82 38.98 92 11 TYR A 103 ? ? -67.07 55.75 93 11 PHE A 144 ? ? -149.97 -32.70 94 11 SER A 145 ? ? -67.85 1.94 95 12 HIS A 10 ? ? -149.29 -30.64 96 12 TYR A 68 ? ? -121.89 -50.73 97 12 SER A 82 ? ? -141.56 58.11 98 12 ALA A 91 ? ? 58.46 1.72 99 12 ASN A 101 ? ? -148.59 -86.55 100 12 ASN A 102 ? ? -153.12 13.12 101 12 LEU A 107 ? ? -104.84 74.99 102 12 SER A 111 ? ? -57.97 -3.88 103 12 ASN A 128 ? ? -130.03 -31.43 104 13 HIS A 10 ? ? -67.97 6.03 105 13 ALA A 16 ? ? -144.90 12.55 106 13 LEU A 31 ? ? 57.10 -156.18 107 13 SER A 82 ? ? -152.56 57.51 108 13 ALA A 91 ? ? 57.65 4.56 109 13 ASN A 101 ? ? -145.99 -83.84 110 13 ASN A 102 ? ? -154.57 13.82 111 13 LEU A 107 ? ? -115.80 74.85 112 13 SER A 145 ? ? -142.13 -5.99 113 14 SER A 11 ? ? 49.69 27.58 114 14 LEU A 31 ? ? 57.25 -161.92 115 14 SER A 82 ? ? -143.26 59.18 116 14 ASN A 101 ? ? -140.33 -54.60 117 14 ASN A 102 ? ? 136.75 26.50 118 14 ARG A 121 ? ? 53.14 19.68 119 14 PHE A 144 ? ? -152.54 -27.61 120 14 SER A 145 ? ? -67.98 4.33 121 15 VAL A 17 ? ? -141.40 -57.61 122 15 THR A 18 ? ? -167.10 2.09 123 15 LEU A 31 ? ? 54.18 -144.52 124 15 ASN A 84 ? ? -68.88 5.31 125 15 ALA A 91 ? ? 56.66 -3.83 126 15 ASN A 101 ? ? -152.92 57.03 127 15 ASN A 102 ? ? 58.79 19.42 128 15 SER A 111 ? ? -59.01 -4.82 129 16 SER A 11 ? ? -149.53 18.98 130 16 VAL A 17 ? ? -135.31 -60.44 131 16 THR A 18 ? ? -168.33 16.19 132 16 LEU A 31 ? ? 58.79 -154.74 133 16 ASN A 84 ? ? -69.45 2.79 134 16 ALA A 91 ? ? 56.32 -1.75 135 16 ASN A 101 ? ? -151.38 43.08 136 16 LEU A 107 ? ? -108.07 78.35 137 17 HIS A 9 ? ? -161.53 -45.33 138 17 HIS A 10 ? ? -151.90 -13.17 139 17 ALA A 16 ? ? 57.49 14.20 140 17 LEU A 31 ? ? 51.99 -165.46 141 17 SER A 82 ? ? -151.28 64.22 142 17 ALA A 91 ? ? 55.99 4.74 143 17 ASN A 101 ? ? -149.88 39.42 144 17 LEU A 107 ? ? -118.63 76.16 145 17 ARG A 121 ? ? 49.84 27.58 146 18 HIS A 10 ? ? 61.07 -23.43 147 18 LEU A 31 ? ? 56.63 -159.43 148 18 SER A 82 ? ? -148.41 59.69 149 18 ALA A 91 ? ? 57.35 0.15 150 18 ASN A 101 ? ? -156.43 40.03 151 18 ASN A 129 ? ? -144.63 -8.59 152 19 ASP A 13 ? ? -151.38 -27.00 153 19 LEU A 31 ? ? 55.67 -157.22 154 19 SER A 82 ? ? -142.48 56.85 155 19 ALA A 91 ? ? 56.60 -1.47 156 19 ASN A 101 ? ? -144.80 47.12 157 19 ASN A 128 ? ? -131.14 -30.66 158 20 HIS A 5 ? ? -157.53 -27.53 159 20 PRO A 15 ? ? -49.67 156.68 160 20 ALA A 16 ? ? -143.27 -3.59 161 20 LEU A 31 ? ? 58.18 -159.27 162 20 SER A 70 ? ? -140.19 -24.52 163 20 ALA A 91 ? ? 56.99 0.78 164 20 ASN A 101 ? ? -150.07 -87.71 165 20 ASN A 102 ? ? -147.17 10.56 166 20 LEU A 107 ? ? -116.84 71.18 167 20 SER A 111 ? ? -63.34 2.39 168 20 ARG A 121 ? ? 58.44 11.21 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 MAG 1 B MAG 1 B MAG 2 n B 2 FUC 2 B FUC 2 B FUC 3 n B 2 NAG 3 B NAG 3 B NAG 1 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 LFucpa FUC 'COMMON NAME' GMML 1.0 a-L-fucopyranose FUC 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-L-Fucp FUC 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Fuc MAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 'DGlcpNAc[1Me]b' MAG 'COMMON NAME' GMML 1.0 1-methyl-N-acetyl-b-D-glucopyranose MAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-methyl-N-acetyl-D-glucosamine NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 'LFucpa1-3[DGlcpNAcb1-4]DGlcpNAc[1Me]b1-OME' 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/3,3,2/[a2122h-1b_1-5_1*OC_2*NCC/3=O][a1221m-1a_1-5][a2122h-1b_1-5_2*NCC/3=O]/1-2-3/a3-b1_a4-c1' WURCS PDB2Glycan 1.1.0 3 2 '[][methyl]{[(1+1)][b-D-GlcpNAc]{[(3+1)][a-L-Fucp]{}[(4+1)][b-D-GlcpNAc]{}}}' LINUCS PDB-CARE ? # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 2 2 FUC C1 O1 1 MAG O3 HO3 sing ? 2 2 3 NAG C1 O1 1 MAG O4 HO4 sing ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 MAG 1 n 2 FUC 2 n 2 NAG 3 n #