data_2LL3 # _entry.id 2LL3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LL3 pdb_00002ll3 10.2210/pdb2ll3/pdb RCSB RCSB102513 ? ? BMRB 17667 ? ? WWPDB D_1000102513 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 2LL4 PDB 'Solution structure of TgMIC4 apple-5 in bound-state' unspecified 17667 BMRB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LL3 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-10-26 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Cowper, B.' 1 'Matthews, S.' 2 # _citation.id primary _citation.title 'Galactose Recognition by the Apicomplexan Parasite Toxoplasma gondii.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 287 _citation.page_first 16720 _citation.page_last 16733 _citation.year 2012 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22399295 _citation.pdbx_database_id_DOI 10.1074/jbc.M111.325928 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Marchant, J.' 1 ? primary 'Cowper, B.' 2 ? primary 'Liu, Y.' 3 ? primary 'Lai, L.' 4 ? primary 'Pinzan, C.' 5 ? primary 'Marq, J.B.' 6 ? primary 'Friedrich, N.' 7 ? primary 'Sawmynaden, K.' 8 ? primary 'Liew, L.' 9 ? primary 'Chai, W.' 10 ? primary 'Childs, R.A.' 11 ? primary 'Saouros, S.' 12 ? primary 'Simpson, P.' 13 ? primary 'Roque Barreira, M.C.' 14 ? primary 'Feizi, T.' 15 ? primary 'Soldati-Favre, D.' 16 ? primary 'Matthews, S.' 17 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Micronemal protein 4' _entity.formula_weight 9158.231 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Apple-5 domain residues 410-491' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SPDFHDEVECVHTGNIGSKAQTIGEVKRASSLSECRARCQAEKECSHYTYNVKSGLCYPKRGKPQFYKYLGDMTGSRTCD TS ; _entity_poly.pdbx_seq_one_letter_code_can ;SPDFHDEVECVHTGNIGSKAQTIGEVKRASSLSECRARCQAEKECSHYTYNVKSGLCYPKRGKPQFYKYLGDMTGSRTCD TS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 PRO n 1 3 ASP n 1 4 PHE n 1 5 HIS n 1 6 ASP n 1 7 GLU n 1 8 VAL n 1 9 GLU n 1 10 CYS n 1 11 VAL n 1 12 HIS n 1 13 THR n 1 14 GLY n 1 15 ASN n 1 16 ILE n 1 17 GLY n 1 18 SER n 1 19 LYS n 1 20 ALA n 1 21 GLN n 1 22 THR n 1 23 ILE n 1 24 GLY n 1 25 GLU n 1 26 VAL n 1 27 LYS n 1 28 ARG n 1 29 ALA n 1 30 SER n 1 31 SER n 1 32 LEU n 1 33 SER n 1 34 GLU n 1 35 CYS n 1 36 ARG n 1 37 ALA n 1 38 ARG n 1 39 CYS n 1 40 GLN n 1 41 ALA n 1 42 GLU n 1 43 LYS n 1 44 GLU n 1 45 CYS n 1 46 SER n 1 47 HIS n 1 48 TYR n 1 49 THR n 1 50 TYR n 1 51 ASN n 1 52 VAL n 1 53 LYS n 1 54 SER n 1 55 GLY n 1 56 LEU n 1 57 CYS n 1 58 TYR n 1 59 PRO n 1 60 LYS n 1 61 ARG n 1 62 GLY n 1 63 LYS n 1 64 PRO n 1 65 GLN n 1 66 PHE n 1 67 TYR n 1 68 LYS n 1 69 TYR n 1 70 LEU n 1 71 GLY n 1 72 ASP n 1 73 MET n 1 74 THR n 1 75 GLY n 1 76 SER n 1 77 ARG n 1 78 THR n 1 79 CYS n 1 80 ASP n 1 81 THR n 1 82 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MIC4, TgIb.0680' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Toxoplasma gondii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5811 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Origami B (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'pET-32 Xa/LIC' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MIC4_TOXGO _struct_ref.pdbx_db_accession Q9XZH7 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SPDFHDEVECVHTGNIGSKAQTIGEVKRASSLSECRARCQAEKECSHYTYNVKSGLCYPKRGKPQFYKYLGDMTGSRTCD TS ; _struct_ref.pdbx_align_begin 410 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LL3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 82 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9XZH7 _struct_ref_seq.db_align_beg 410 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 491 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 82 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCACB' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCO' 1 5 1 '3D HN(CO)CA' 1 6 2 '3D HCCH-TOCSY' 1 7 2 '3D 1H-13C NOESY' 1 8 2 '3D 1H-15N NOESY' 1 9 1 '3D C(CO)NH' 1 10 1 '3D HBHA(CO)NH' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.7 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '200-500 uM [U-98% 13C; U-98% 15N] TgMIC4-A5, 20 mM potassium phosphate, 100 mM sodium chloride, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '200-500 uM [U-98% 13C; U-98% 15N] TgMIC4-A5, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker AVANCE 1 'Bruker Avance' 800 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2LL3 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 10 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LL3 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LL3 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Johnson, One Moon Scientific' 'peak picking' NMRView ? 1 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRView ? 2 'Johnson, One Moon Scientific' 'data analysis' NMRView ? 3 ;Linge, O'Donoghue and Nilges ; refinement ARIA 2.1 4 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 5 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LL3 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LL3 _struct.title 'The solution structure of TgMIC4 apple-5 domain' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LL3 _struct_keywords.pdbx_keywords 'CELL ADHESION' _struct_keywords.text 'CELL ADHESION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 31 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 42 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 31 _struct_conf.end_auth_comp_id GLU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 42 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 79 SG ? ? A CYS 10 A CYS 79 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf2 disulf ? ? A CYS 35 SG ? ? ? 1_555 A CYS 57 SG ? ? A CYS 35 A CYS 57 1_555 ? ? ? ? ? ? ? 2.028 ? ? disulf3 disulf ? ? A CYS 39 SG ? ? ? 1_555 A CYS 45 SG ? ? A CYS 39 A CYS 45 1_555 ? ? ? ? ? ? ? 2.030 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 16 ? SER A 18 ? ILE A 16 SER A 18 A 2 PHE A 66 ? LYS A 68 ? PHE A 66 LYS A 68 B 1 LYS A 27 ? ARG A 28 ? LYS A 27 ARG A 28 B 2 LEU A 56 ? ARG A 61 ? LEU A 56 ARG A 61 B 3 CYS A 45 ? ASN A 51 ? CYS A 45 ASN A 51 B 4 ASP A 72 ? GLY A 75 ? ASP A 72 GLY A 75 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLY A 17 ? N GLY A 17 O TYR A 67 ? O TYR A 67 B 1 2 N LYS A 27 ? N LYS A 27 O CYS A 57 ? O CYS A 57 B 2 3 O TYR A 58 ? O TYR A 58 N THR A 49 ? N THR A 49 B 3 4 N TYR A 50 ? N TYR A 50 O MET A 73 ? O MET A 73 # _atom_sites.entry_id 2LL3 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 ASP 3 3 ? ? ? A . n A 1 4 PHE 4 4 ? ? ? A . n A 1 5 HIS 5 5 ? ? ? A . n A 1 6 ASP 6 6 ? ? ? A . n A 1 7 GLU 7 7 ? ? ? A . n A 1 8 VAL 8 8 ? ? ? A . n A 1 9 GLU 9 9 ? ? ? A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 HIS 47 47 47 HIS HIS A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 CYS 57 57 57 CYS CYS A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 MET 73 73 73 MET MET A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 CYS 79 79 79 CYS CYS A . n A 1 80 ASP 80 80 ? ? ? A . n A 1 81 THR 81 81 ? ? ? A . n A 1 82 SER 82 82 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-04-04 2 'Structure model' 1 1 2012-05-30 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id TgMIC4-A5-1 ? 200-500 uM '[U-98% 13C; U-98% 15N]' 1 'potassium phosphate-2' 20 ? mM ? 1 'sodium chloride-3' 100 ? mM ? 1 TgMIC4-A5-4 ? 200-500 uM '[U-98% 13C; U-98% 15N]' 2 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 5 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 SER _pdbx_validate_close_contact.auth_seq_id_1 18 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HZ1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 LYS _pdbx_validate_close_contact.auth_seq_id_2 60 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 11 ? ? -141.71 31.82 2 1 THR A 13 ? ? 43.34 -104.88 3 1 ARG A 77 ? ? 68.74 -72.03 4 2 HIS A 12 ? ? -145.59 -43.25 5 2 ASN A 15 ? ? -99.25 43.86 6 2 SER A 76 ? ? -79.13 43.03 7 2 ARG A 77 ? ? 67.49 -68.41 8 2 THR A 78 ? ? -92.32 -158.46 9 3 ASN A 15 ? ? -109.99 51.12 10 3 THR A 78 ? ? -144.87 -53.93 11 5 VAL A 11 ? ? 59.08 80.05 12 5 THR A 13 ? ? -74.98 -80.28 13 5 ARG A 77 ? ? 49.63 21.95 14 6 THR A 13 ? ? 60.75 -93.45 15 7 HIS A 12 ? ? -140.94 -62.69 16 7 THR A 13 ? ? -100.26 67.45 17 8 THR A 78 ? ? 63.71 84.43 18 9 THR A 13 ? ? 66.01 -113.18 19 9 SER A 76 ? ? -62.19 -75.64 20 9 ARG A 77 ? ? -176.91 -43.31 21 10 ASN A 15 ? ? -162.54 41.97 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1 ? A SER 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A ASP 3 ? A ASP 3 4 1 Y 1 A PHE 4 ? A PHE 4 5 1 Y 1 A HIS 5 ? A HIS 5 6 1 Y 1 A ASP 6 ? A ASP 6 7 1 Y 1 A GLU 7 ? A GLU 7 8 1 Y 1 A VAL 8 ? A VAL 8 9 1 Y 1 A GLU 9 ? A GLU 9 10 1 Y 1 A ASP 80 ? A ASP 80 11 1 Y 1 A THR 81 ? A THR 81 12 1 Y 1 A SER 82 ? A SER 82 13 2 Y 1 A SER 1 ? A SER 1 14 2 Y 1 A PRO 2 ? A PRO 2 15 2 Y 1 A ASP 3 ? A ASP 3 16 2 Y 1 A PHE 4 ? A PHE 4 17 2 Y 1 A HIS 5 ? A HIS 5 18 2 Y 1 A ASP 6 ? A ASP 6 19 2 Y 1 A GLU 7 ? A GLU 7 20 2 Y 1 A VAL 8 ? A VAL 8 21 2 Y 1 A GLU 9 ? A GLU 9 22 2 Y 1 A ASP 80 ? A ASP 80 23 2 Y 1 A THR 81 ? A THR 81 24 2 Y 1 A SER 82 ? A SER 82 25 3 Y 1 A SER 1 ? A SER 1 26 3 Y 1 A PRO 2 ? A PRO 2 27 3 Y 1 A ASP 3 ? A ASP 3 28 3 Y 1 A PHE 4 ? A PHE 4 29 3 Y 1 A HIS 5 ? A HIS 5 30 3 Y 1 A ASP 6 ? A ASP 6 31 3 Y 1 A GLU 7 ? A GLU 7 32 3 Y 1 A VAL 8 ? A VAL 8 33 3 Y 1 A GLU 9 ? A GLU 9 34 3 Y 1 A ASP 80 ? A ASP 80 35 3 Y 1 A THR 81 ? A THR 81 36 3 Y 1 A SER 82 ? A SER 82 37 4 Y 1 A SER 1 ? A SER 1 38 4 Y 1 A PRO 2 ? A PRO 2 39 4 Y 1 A ASP 3 ? A ASP 3 40 4 Y 1 A PHE 4 ? A PHE 4 41 4 Y 1 A HIS 5 ? A HIS 5 42 4 Y 1 A ASP 6 ? A ASP 6 43 4 Y 1 A GLU 7 ? A GLU 7 44 4 Y 1 A VAL 8 ? A VAL 8 45 4 Y 1 A GLU 9 ? A GLU 9 46 4 Y 1 A ASP 80 ? A ASP 80 47 4 Y 1 A THR 81 ? A THR 81 48 4 Y 1 A SER 82 ? A SER 82 49 5 Y 1 A SER 1 ? A SER 1 50 5 Y 1 A PRO 2 ? A PRO 2 51 5 Y 1 A ASP 3 ? A ASP 3 52 5 Y 1 A PHE 4 ? A PHE 4 53 5 Y 1 A HIS 5 ? A HIS 5 54 5 Y 1 A ASP 6 ? A ASP 6 55 5 Y 1 A GLU 7 ? A GLU 7 56 5 Y 1 A VAL 8 ? A VAL 8 57 5 Y 1 A GLU 9 ? A GLU 9 58 5 Y 1 A ASP 80 ? A ASP 80 59 5 Y 1 A THR 81 ? A THR 81 60 5 Y 1 A SER 82 ? A SER 82 61 6 Y 1 A SER 1 ? A SER 1 62 6 Y 1 A PRO 2 ? A PRO 2 63 6 Y 1 A ASP 3 ? A ASP 3 64 6 Y 1 A PHE 4 ? A PHE 4 65 6 Y 1 A HIS 5 ? A HIS 5 66 6 Y 1 A ASP 6 ? A ASP 6 67 6 Y 1 A GLU 7 ? A GLU 7 68 6 Y 1 A VAL 8 ? A VAL 8 69 6 Y 1 A GLU 9 ? A GLU 9 70 6 Y 1 A ASP 80 ? A ASP 80 71 6 Y 1 A THR 81 ? A THR 81 72 6 Y 1 A SER 82 ? A SER 82 73 7 Y 1 A SER 1 ? A SER 1 74 7 Y 1 A PRO 2 ? A PRO 2 75 7 Y 1 A ASP 3 ? A ASP 3 76 7 Y 1 A PHE 4 ? A PHE 4 77 7 Y 1 A HIS 5 ? A HIS 5 78 7 Y 1 A ASP 6 ? A ASP 6 79 7 Y 1 A GLU 7 ? A GLU 7 80 7 Y 1 A VAL 8 ? A VAL 8 81 7 Y 1 A GLU 9 ? A GLU 9 82 7 Y 1 A ASP 80 ? A ASP 80 83 7 Y 1 A THR 81 ? A THR 81 84 7 Y 1 A SER 82 ? A SER 82 85 8 Y 1 A SER 1 ? A SER 1 86 8 Y 1 A PRO 2 ? A PRO 2 87 8 Y 1 A ASP 3 ? A ASP 3 88 8 Y 1 A PHE 4 ? A PHE 4 89 8 Y 1 A HIS 5 ? A HIS 5 90 8 Y 1 A ASP 6 ? A ASP 6 91 8 Y 1 A GLU 7 ? A GLU 7 92 8 Y 1 A VAL 8 ? A VAL 8 93 8 Y 1 A GLU 9 ? A GLU 9 94 8 Y 1 A ASP 80 ? A ASP 80 95 8 Y 1 A THR 81 ? A THR 81 96 8 Y 1 A SER 82 ? A SER 82 97 9 Y 1 A SER 1 ? A SER 1 98 9 Y 1 A PRO 2 ? A PRO 2 99 9 Y 1 A ASP 3 ? A ASP 3 100 9 Y 1 A PHE 4 ? A PHE 4 101 9 Y 1 A HIS 5 ? A HIS 5 102 9 Y 1 A ASP 6 ? A ASP 6 103 9 Y 1 A GLU 7 ? A GLU 7 104 9 Y 1 A VAL 8 ? A VAL 8 105 9 Y 1 A GLU 9 ? A GLU 9 106 9 Y 1 A ASP 80 ? A ASP 80 107 9 Y 1 A THR 81 ? A THR 81 108 9 Y 1 A SER 82 ? A SER 82 109 10 Y 1 A SER 1 ? A SER 1 110 10 Y 1 A PRO 2 ? A PRO 2 111 10 Y 1 A ASP 3 ? A ASP 3 112 10 Y 1 A PHE 4 ? A PHE 4 113 10 Y 1 A HIS 5 ? A HIS 5 114 10 Y 1 A ASP 6 ? A ASP 6 115 10 Y 1 A GLU 7 ? A GLU 7 116 10 Y 1 A VAL 8 ? A VAL 8 117 10 Y 1 A GLU 9 ? A GLU 9 118 10 Y 1 A ASP 80 ? A ASP 80 119 10 Y 1 A THR 81 ? A THR 81 120 10 Y 1 A SER 82 ? A SER 82 #