data_2LLQ # _entry.id 2LLQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2LLQ RCSB RCSB102536 BMRB 18084 WWPDB D_1000102536 # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 18084 BMRB . unspecified 2LLO PDB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LLQ _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-11-15 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Zhang, Y.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'Structural basis for Ca2+-induced activation and dimerization of estrogen receptor alpha by calmodulin.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 287 _citation.page_first 9336 _citation.page_last 9344 _citation.year 2012 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22275375 _citation.pdbx_database_id_DOI 10.1074/jbc.M111.334797 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Zhang, Y.' 1 primary 'Li, Z.' 2 primary 'Sacks, D.B.' 3 primary 'Ames, J.B.' 4 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Calmodulin 7737.468 1 ? ? 'EF-hand domains 3 and 4, residues 83-149' ? 2 polymer syn 'Estrogen receptor' 2202.645 1 ? ? 'UNP residues 287-305' ? 3 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 CaM 2 'ER, ER-alpha, Estradiol receptor, Nuclear receptor subfamily 3 group A member 1' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no EEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK EEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK A ? 2 'polypeptide(L)' no no RAANLWPSPLMIKRSKKNS RAANLWPSPLMIKRSKKNS B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 GLU n 1 3 GLU n 1 4 ILE n 1 5 ARG n 1 6 GLU n 1 7 ALA n 1 8 PHE n 1 9 ARG n 1 10 VAL n 1 11 PHE n 1 12 ASP n 1 13 LYS n 1 14 ASP n 1 15 GLY n 1 16 ASN n 1 17 GLY n 1 18 TYR n 1 19 ILE n 1 20 SER n 1 21 ALA n 1 22 ALA n 1 23 GLU n 1 24 LEU n 1 25 ARG n 1 26 HIS n 1 27 VAL n 1 28 MET n 1 29 THR n 1 30 ASN n 1 31 LEU n 1 32 GLY n 1 33 GLU n 1 34 LYS n 1 35 LEU n 1 36 THR n 1 37 ASP n 1 38 GLU n 1 39 GLU n 1 40 VAL n 1 41 ASP n 1 42 GLU n 1 43 MET n 1 44 ILE n 1 45 ARG n 1 46 GLU n 1 47 ALA n 1 48 ASP n 1 49 ILE n 1 50 ASP n 1 51 GLY n 1 52 ASP n 1 53 GLY n 1 54 GLN n 1 55 VAL n 1 56 ASN n 1 57 TYR n 1 58 GLU n 1 59 GLU n 1 60 PHE n 1 61 VAL n 1 62 GLN n 1 63 MET n 1 64 MET n 1 65 THR n 1 66 ALA n 1 67 LYS n 2 1 ARG n 2 2 ALA n 2 3 ALA n 2 4 ASN n 2 5 LEU n 2 6 TRP n 2 7 PRO n 2 8 SER n 2 9 PRO n 2 10 LEU n 2 11 MET n 2 12 ILE n 2 13 LYS n 2 14 ARG n 2 15 SER n 2 16 LYS n 2 17 LYS n 2 18 ASN n 2 19 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'clawed frog,common platanna,platanna' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'calm1, calm2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Xenopus laevis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 8355 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET3a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP CALM_XENLA P62155 1 EEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 83 ? 2 UNP ESR1_HUMAN P03372 2 RAANLWPSPLMIKRSKKNS 287 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2LLQ A 1 ? 67 ? P62155 83 ? 149 ? 82 148 2 2 2LLQ B 1 ? 19 ? P03372 287 ? 305 ? 287 305 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D CBCA(CO)NH' 1 3 1 '3D HNCACB' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.02 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1 mM [U-100% 13C; U-100% 15N] protein, 93% H2O/7% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '93% H2O/7% D2O' # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model Avance _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2LLQ _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LLQ _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LLQ _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 1 Goddard 'chemical shift assignment' SPARKY ? 2 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 3 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LLQ _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LLQ _struct.title 'Solution nmr-derived structure of calmodulin c-lobe bound with er alpha peptide' _struct.pdbx_descriptor 'Calmodulin, Estrogen receptor' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LLQ _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN/HORMONE RECEPTOR' _struct_keywords.text 'METAL BINDING PROTEIN-HORMONE RECEPTOR complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 1 ? ASP A 12 ? GLU A 82 ASP A 93 1 ? 12 HELX_P HELX_P2 2 SER A 20 ? GLY A 32 ? SER A 101 GLY A 113 1 ? 13 HELX_P HELX_P3 3 THR A 36 ? GLU A 46 ? THR A 117 GLU A 127 1 ? 11 HELX_P HELX_P4 4 ASN A 56 ? THR A 65 ? ASN A 137 THR A 146 1 ? 10 HELX_P HELX_P5 5 ALA B 2 ? LEU B 5 ? ALA B 288 LEU B 291 5 ? 4 HELX_P HELX_P6 6 TRP B 6 ? SER B 19 ? TRP B 292 SER B 305 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A GLU 23 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 104 A CA 1000 1_555 ? ? ? ? ? ? ? 1.802 ? metalc2 metalc ? ? A GLN 54 O ? ? ? 1_555 D CA . CA ? ? A GLN 135 A CA 1001 1_555 ? ? ? ? ? ? ? 2.396 ? metalc3 metalc ? ? A ASN 16 OD1 ? ? ? 1_555 C CA . CA ? ? A ASN 97 A CA 1000 1_555 ? ? ? ? ? ? ? 2.483 ? metalc4 metalc ? ? A TYR 18 O ? ? ? 1_555 C CA . CA ? ? A TYR 99 A CA 1000 1_555 ? ? ? ? ? ? ? 2.501 ? metalc5 metalc ? ? A GLU 59 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 140 A CA 1001 1_555 ? ? ? ? ? ? ? 2.545 ? metalc6 metalc ? ? A GLU 23 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 104 A CA 1000 1_555 ? ? ? ? ? ? ? 2.013 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA A 1000' AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA A 1001' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ASP A 12 ? ASP A 93 . ? 1_555 ? 2 AC1 5 ASP A 14 ? ASP A 95 . ? 1_555 ? 3 AC1 5 ASN A 16 ? ASN A 97 . ? 1_555 ? 4 AC1 5 TYR A 18 ? TYR A 99 . ? 1_555 ? 5 AC1 5 GLU A 23 ? GLU A 104 . ? 1_555 ? 6 AC2 5 ASP A 48 ? ASP A 129 . ? 1_555 ? 7 AC2 5 ASP A 50 ? ASP A 131 . ? 1_555 ? 8 AC2 5 ASP A 52 ? ASP A 133 . ? 1_555 ? 9 AC2 5 GLN A 54 ? GLN A 135 . ? 1_555 ? 10 AC2 5 GLU A 59 ? GLU A 140 . ? 1_555 ? # _atom_sites.entry_id 2LLQ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 82 82 GLU GLU A . n A 1 2 GLU 2 83 83 GLU GLU A . n A 1 3 GLU 3 84 84 GLU GLU A . n A 1 4 ILE 4 85 85 ILE ILE A . n A 1 5 ARG 5 86 86 ARG ARG A . n A 1 6 GLU 6 87 87 GLU GLU A . n A 1 7 ALA 7 88 88 ALA ALA A . n A 1 8 PHE 8 89 89 PHE PHE A . n A 1 9 ARG 9 90 90 ARG ARG A . n A 1 10 VAL 10 91 91 VAL VAL A . n A 1 11 PHE 11 92 92 PHE PHE A . n A 1 12 ASP 12 93 93 ASP ASP A . n A 1 13 LYS 13 94 94 LYS LYS A . n A 1 14 ASP 14 95 95 ASP ASP A . n A 1 15 GLY 15 96 96 GLY GLY A . n A 1 16 ASN 16 97 97 ASN ASN A . n A 1 17 GLY 17 98 98 GLY GLY A . n A 1 18 TYR 18 99 99 TYR TYR A . n A 1 19 ILE 19 100 100 ILE ILE A . n A 1 20 SER 20 101 101 SER SER A . n A 1 21 ALA 21 102 102 ALA ALA A . n A 1 22 ALA 22 103 103 ALA ALA A . n A 1 23 GLU 23 104 104 GLU GLU A . n A 1 24 LEU 24 105 105 LEU LEU A . n A 1 25 ARG 25 106 106 ARG ARG A . n A 1 26 HIS 26 107 107 HIS HIS A . n A 1 27 VAL 27 108 108 VAL VAL A . n A 1 28 MET 28 109 109 MET MET A . n A 1 29 THR 29 110 110 THR THR A . n A 1 30 ASN 30 111 111 ASN ASN A . n A 1 31 LEU 31 112 112 LEU LEU A . n A 1 32 GLY 32 113 113 GLY GLY A . n A 1 33 GLU 33 114 114 GLU GLU A . n A 1 34 LYS 34 115 115 LYS LYS A . n A 1 35 LEU 35 116 116 LEU LEU A . n A 1 36 THR 36 117 117 THR THR A . n A 1 37 ASP 37 118 118 ASP ASP A . n A 1 38 GLU 38 119 119 GLU GLU A . n A 1 39 GLU 39 120 120 GLU GLU A . n A 1 40 VAL 40 121 121 VAL VAL A . n A 1 41 ASP 41 122 122 ASP ASP A . n A 1 42 GLU 42 123 123 GLU GLU A . n A 1 43 MET 43 124 124 MET MET A . n A 1 44 ILE 44 125 125 ILE ILE A . n A 1 45 ARG 45 126 126 ARG ARG A . n A 1 46 GLU 46 127 127 GLU GLU A . n A 1 47 ALA 47 128 128 ALA ALA A . n A 1 48 ASP 48 129 129 ASP ASP A . n A 1 49 ILE 49 130 130 ILE ILE A . n A 1 50 ASP 50 131 131 ASP ASP A . n A 1 51 GLY 51 132 132 GLY GLY A . n A 1 52 ASP 52 133 133 ASP ASP A . n A 1 53 GLY 53 134 134 GLY GLY A . n A 1 54 GLN 54 135 135 GLN GLN A . n A 1 55 VAL 55 136 136 VAL VAL A . n A 1 56 ASN 56 137 137 ASN ASN A . n A 1 57 TYR 57 138 138 TYR TYR A . n A 1 58 GLU 58 139 139 GLU GLU A . n A 1 59 GLU 59 140 140 GLU GLU A . n A 1 60 PHE 60 141 141 PHE PHE A . n A 1 61 VAL 61 142 142 VAL VAL A . n A 1 62 GLN 62 143 143 GLN GLN A . n A 1 63 MET 63 144 144 MET MET A . n A 1 64 MET 64 145 145 MET MET A . n A 1 65 THR 65 146 146 THR THR A . n A 1 66 ALA 66 147 147 ALA ALA A . n A 1 67 LYS 67 148 148 LYS LYS A . n B 2 1 ARG 1 287 287 ARG ARG B . n B 2 2 ALA 2 288 288 ALA ALA B . n B 2 3 ALA 3 289 289 ALA ALA B . n B 2 4 ASN 4 290 290 ASN ASN B . n B 2 5 LEU 5 291 291 LEU LEU B . n B 2 6 TRP 6 292 292 TRP TRP B . n B 2 7 PRO 7 293 293 PRO PRO B . n B 2 8 SER 8 294 294 SER SER B . n B 2 9 PRO 9 295 295 PRO PRO B . n B 2 10 LEU 10 296 296 LEU LEU B . n B 2 11 MET 11 297 297 MET MET B . n B 2 12 ILE 12 298 298 ILE ILE B . n B 2 13 LYS 13 299 299 LYS LYS B . n B 2 14 ARG 14 300 300 ARG ARG B . n B 2 15 SER 15 301 301 SER SER B . n B 2 16 LYS 16 302 302 LYS LYS B . n B 2 17 LYS 17 303 303 LYS LYS B . n B 2 18 ASN 18 304 304 ASN ASN B . n B 2 19 SER 19 305 305 SER SER B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 CA 1 1000 1000 CA CA A . D 3 CA 1 1001 1001 CA CA A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 23 ? A GLU 104 ? 1_555 CA ? C CA . ? A CA 1000 ? 1_555 OD1 ? A ASN 16 ? A ASN 97 ? 1_555 123.8 ? 2 OE1 ? A GLU 23 ? A GLU 104 ? 1_555 CA ? C CA . ? A CA 1000 ? 1_555 O ? A TYR 18 ? A TYR 99 ? 1_555 77.2 ? 3 OD1 ? A ASN 16 ? A ASN 97 ? 1_555 CA ? C CA . ? A CA 1000 ? 1_555 O ? A TYR 18 ? A TYR 99 ? 1_555 70.3 ? 4 OE1 ? A GLU 23 ? A GLU 104 ? 1_555 CA ? C CA . ? A CA 1000 ? 1_555 OE2 ? A GLU 23 ? A GLU 104 ? 1_555 68.5 ? 5 OD1 ? A ASN 16 ? A ASN 97 ? 1_555 CA ? C CA . ? A CA 1000 ? 1_555 OE2 ? A GLU 23 ? A GLU 104 ? 1_555 166.1 ? 6 O ? A TYR 18 ? A TYR 99 ? 1_555 CA ? C CA . ? A CA 1000 ? 1_555 OE2 ? A GLU 23 ? A GLU 104 ? 1_555 121.8 ? 7 O ? A GLN 54 ? A GLN 135 ? 1_555 CA ? D CA . ? A CA 1001 ? 1_555 OE2 ? A GLU 59 ? A GLU 140 ? 1_555 111.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-02-01 2 'Structure model' 1 1 2013-08-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_nmr_exptl_sample.component entity_1-1 _pdbx_nmr_exptl_sample.concentration 1 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-100% 13C; U-100% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 84 ? ? HZ2 B LYS 299 ? ? 1.58 2 1 O A ARG 106 ? ? HG1 A THR 110 ? ? 1.60 3 3 OE1 A GLU 84 ? ? HZ3 B LYS 303 ? ? 1.59 4 3 H A ILE 130 ? ? OE2 A GLU 140 ? ? 1.60 5 4 H A ILE 130 ? ? OE2 A GLU 140 ? ? 1.59 6 4 HH12 A ARG 106 ? ? OD1 A ASP 118 ? ? 1.60 7 5 OE1 A GLU 84 ? ? HZ3 B LYS 303 ? ? 1.58 8 5 OE2 A GLU 84 ? ? HZ3 B LYS 299 ? ? 1.60 9 6 HH12 A ARG 106 ? ? OD1 A ASP 118 ? ? 1.60 10 9 OE1 A GLU 87 ? ? HZ1 B LYS 299 ? ? 1.58 11 9 OE2 A GLU 84 ? ? HZ3 B LYS 303 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 146 ? ? -102.43 77.88 2 2 GLU A 83 ? ? -52.82 -71.08 3 3 THR A 146 ? ? -97.70 55.92 4 4 VAL A 108 ? ? -120.04 -54.92 5 5 THR A 146 ? ? -90.01 50.47 6 6 VAL A 108 ? ? -120.59 -66.87 7 6 THR A 146 ? ? -86.79 47.62 8 8 THR A 146 ? ? -97.64 48.68 9 9 ALA B 289 ? ? -39.39 -29.88 10 10 THR A 146 ? ? -96.32 31.14 # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA #