data_2LMC # _entry.id 2LMC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2LMC RCSB RCSB102558 BMRB 18111 WWPDB D_1000102558 # _pdbx_database_related.db_id 18111 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LMC _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-11-29 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Liu, M.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'Structural and Mechanistic Basis for the Inhibition of Escherichia coli RNA Polymerase by T7 Gp2.' _citation.journal_abbrev Mol.Cell _citation.journal_volume 47 _citation.page_first 755 _citation.page_last 766 _citation.year 2012 _citation.journal_id_ASTM MOCEFL _citation.country US _citation.journal_id_ISSN 1097-2765 _citation.journal_id_CSD 2168 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22819324 _citation.pdbx_database_id_DOI 10.1016/j.molcel.2012.06.013 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'James, E.' 1 primary 'Liu, M.' 2 primary 'Sheppard, C.' 3 primary 'Mekler, V.' 4 primary 'Camara, B.' 5 primary 'Liu, B.' 6 primary 'Simpson, P.' 7 primary 'Cota, E.' 8 primary 'Severinov, K.' 9 primary 'Matthews, S.' 10 primary 'Wigneshweraraj, S.' 11 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bacterial RNA polymerase inhibitor' 9352.351 1 ? ? ? ? 2 polymer man 'DNA-directed RNA polymerase subunit beta' 9356.563 1 2.7.7.6 ? 'UNP residues 1151-1213' ? # _entity_name_com.entity_id 2 _entity_name_com.name 'RNAP subunit beta, RNA polymerase subunit beta, Transcriptase subunit beta' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MGSSHHHHHHSSGLVPRGSHMSNVNTGSLSVDNKKFWATVESSEHSFEVPIYAETLDEALELAEWQYVPAGFEVTRVRPC VAPK ; ;MGSSHHHHHHSSGLVPRGSHMSNVNTGSLSVDNKKFWATVESSEHSFEVPIYAETLDEALELAEWQYVPAGFEVTRVRPC VAPK ; A ? 2 'polypeptide(L)' no no ;MGSSHHHHHHSSGLVPRGSHMKEPAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFEGERVERGDV ISDG ; ;MGSSHHHHHHSSGLVPRGSHMKEPAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFEGERVERGDV ISDG ; B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 SER n 1 23 ASN n 1 24 VAL n 1 25 ASN n 1 26 THR n 1 27 GLY n 1 28 SER n 1 29 LEU n 1 30 SER n 1 31 VAL n 1 32 ASP n 1 33 ASN n 1 34 LYS n 1 35 LYS n 1 36 PHE n 1 37 TRP n 1 38 ALA n 1 39 THR n 1 40 VAL n 1 41 GLU n 1 42 SER n 1 43 SER n 1 44 GLU n 1 45 HIS n 1 46 SER n 1 47 PHE n 1 48 GLU n 1 49 VAL n 1 50 PRO n 1 51 ILE n 1 52 TYR n 1 53 ALA n 1 54 GLU n 1 55 THR n 1 56 LEU n 1 57 ASP n 1 58 GLU n 1 59 ALA n 1 60 LEU n 1 61 GLU n 1 62 LEU n 1 63 ALA n 1 64 GLU n 1 65 TRP n 1 66 GLN n 1 67 TYR n 1 68 VAL n 1 69 PRO n 1 70 ALA n 1 71 GLY n 1 72 PHE n 1 73 GLU n 1 74 VAL n 1 75 THR n 1 76 ARG n 1 77 VAL n 1 78 ARG n 1 79 PRO n 1 80 CYS n 1 81 VAL n 1 82 ALA n 1 83 PRO n 1 84 LYS n 2 1 MET n 2 2 GLY n 2 3 SER n 2 4 SER n 2 5 HIS n 2 6 HIS n 2 7 HIS n 2 8 HIS n 2 9 HIS n 2 10 HIS n 2 11 SER n 2 12 SER n 2 13 GLY n 2 14 LEU n 2 15 VAL n 2 16 PRO n 2 17 ARG n 2 18 GLY n 2 19 SER n 2 20 HIS n 2 21 MET n 2 22 LYS n 2 23 GLU n 2 24 PRO n 2 25 ALA n 2 26 ILE n 2 27 LEU n 2 28 ALA n 2 29 GLU n 2 30 ILE n 2 31 SER n 2 32 GLY n 2 33 ILE n 2 34 VAL n 2 35 SER n 2 36 PHE n 2 37 GLY n 2 38 LYS n 2 39 GLU n 2 40 THR n 2 41 LYS n 2 42 GLY n 2 43 LYS n 2 44 ARG n 2 45 ARG n 2 46 LEU n 2 47 VAL n 2 48 ILE n 2 49 THR n 2 50 PRO n 2 51 VAL n 2 52 ASP n 2 53 GLY n 2 54 SER n 2 55 ASP n 2 56 PRO n 2 57 TYR n 2 58 GLU n 2 59 GLU n 2 60 MET n 2 61 ILE n 2 62 PRO n 2 63 LYS n 2 64 TRP n 2 65 ARG n 2 66 GLN n 2 67 LEU n 2 68 ASN n 2 69 VAL n 2 70 PHE n 2 71 GLU n 2 72 GLY n 2 73 GLU n 2 74 ARG n 2 75 VAL n 2 76 GLU n 2 77 ARG n 2 78 GLY n 2 79 ASP n 2 80 VAL n 2 81 ILE n 2 82 SER n 2 83 ASP n 2 84 GLY n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? ? ? ? ? '2, Gp2' ? ? ? ? ? ? 'Enterobacteria phage T7' 10760 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? pET28b+ ? ? ? ? ? 2 1 sample ? ? ? ? ? 'b3988, JW3951, RNAP, rpoC, tabB' ? K12 ? ? ? ? 'Escherichia coli K-12' 83333 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? pET28b+ ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP VRPI_BPT7 P03704 1 MSNVNTGSLSVDNKKFWATVESSEHSFEVPIYAETLDEALELAEWQYVPAGFEVTRVRPC 1 ? 2 UNP RPOC_ECOLI P0A8T7 2 KEPAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFEGERVERGDVISDG 1151 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2LMC A 21 ? 80 ? P03704 1 ? 60 ? 21 80 2 2 2LMC B 22 ? 84 ? P0A8T7 1151 ? 1213 ? 22 84 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LMC MET A 1 ? UNP P03704 ? ? 'EXPRESSION TAG' 1 1 1 2LMC GLY A 2 ? UNP P03704 ? ? 'EXPRESSION TAG' 2 2 1 2LMC SER A 3 ? UNP P03704 ? ? 'EXPRESSION TAG' 3 3 1 2LMC SER A 4 ? UNP P03704 ? ? 'EXPRESSION TAG' 4 4 1 2LMC HIS A 5 ? UNP P03704 ? ? 'EXPRESSION TAG' 5 5 1 2LMC HIS A 6 ? UNP P03704 ? ? 'EXPRESSION TAG' 6 6 1 2LMC HIS A 7 ? UNP P03704 ? ? 'EXPRESSION TAG' 7 7 1 2LMC HIS A 8 ? UNP P03704 ? ? 'EXPRESSION TAG' 8 8 1 2LMC HIS A 9 ? UNP P03704 ? ? 'EXPRESSION TAG' 9 9 1 2LMC HIS A 10 ? UNP P03704 ? ? 'EXPRESSION TAG' 10 10 1 2LMC SER A 11 ? UNP P03704 ? ? 'EXPRESSION TAG' 11 11 1 2LMC SER A 12 ? UNP P03704 ? ? 'EXPRESSION TAG' 12 12 1 2LMC GLY A 13 ? UNP P03704 ? ? 'EXPRESSION TAG' 13 13 1 2LMC LEU A 14 ? UNP P03704 ? ? 'EXPRESSION TAG' 14 14 1 2LMC VAL A 15 ? UNP P03704 ? ? 'EXPRESSION TAG' 15 15 1 2LMC PRO A 16 ? UNP P03704 ? ? 'EXPRESSION TAG' 16 16 1 2LMC ARG A 17 ? UNP P03704 ? ? 'EXPRESSION TAG' 17 17 1 2LMC GLY A 18 ? UNP P03704 ? ? 'EXPRESSION TAG' 18 18 1 2LMC SER A 19 ? UNP P03704 ? ? 'EXPRESSION TAG' 19 19 1 2LMC HIS A 20 ? UNP P03704 ? ? 'EXPRESSION TAG' 20 20 1 2LMC VAL A 81 ? UNP P03704 ? ? 'EXPRESSION TAG' 81 21 1 2LMC ALA A 82 ? UNP P03704 ? ? 'EXPRESSION TAG' 82 22 1 2LMC PRO A 83 ? UNP P03704 ? ? 'EXPRESSION TAG' 83 23 1 2LMC LYS A 84 ? UNP P03704 ? ? 'EXPRESSION TAG' 84 24 2 2LMC MET B 1 ? UNP P0A8T7 ? ? 'EXPRESSION TAG' 1 25 2 2LMC GLY B 2 ? UNP P0A8T7 ? ? 'EXPRESSION TAG' 2 26 2 2LMC SER B 3 ? UNP P0A8T7 ? ? 'EXPRESSION TAG' 3 27 2 2LMC SER B 4 ? UNP P0A8T7 ? ? 'EXPRESSION TAG' 4 28 2 2LMC HIS B 5 ? UNP P0A8T7 ? ? 'EXPRESSION TAG' 5 29 2 2LMC HIS B 6 ? UNP P0A8T7 ? ? 'EXPRESSION TAG' 6 30 2 2LMC HIS B 7 ? UNP P0A8T7 ? ? 'EXPRESSION TAG' 7 31 2 2LMC HIS B 8 ? UNP P0A8T7 ? ? 'EXPRESSION TAG' 8 32 2 2LMC HIS B 9 ? UNP P0A8T7 ? ? 'EXPRESSION TAG' 9 33 2 2LMC HIS B 10 ? UNP P0A8T7 ? ? 'EXPRESSION TAG' 10 34 2 2LMC SER B 11 ? UNP P0A8T7 ? ? 'EXPRESSION TAG' 11 35 2 2LMC SER B 12 ? UNP P0A8T7 ? ? 'EXPRESSION TAG' 12 36 2 2LMC GLY B 13 ? UNP P0A8T7 ? ? 'EXPRESSION TAG' 13 37 2 2LMC LEU B 14 ? UNP P0A8T7 ? ? 'EXPRESSION TAG' 14 38 2 2LMC VAL B 15 ? UNP P0A8T7 ? ? 'EXPRESSION TAG' 15 39 2 2LMC PRO B 16 ? UNP P0A8T7 ? ? 'EXPRESSION TAG' 16 40 2 2LMC ARG B 17 ? UNP P0A8T7 ? ? 'EXPRESSION TAG' 17 41 2 2LMC GLY B 18 ? UNP P0A8T7 ? ? 'EXPRESSION TAG' 18 42 2 2LMC SER B 19 ? UNP P0A8T7 ? ? 'EXPRESSION TAG' 19 43 2 2LMC HIS B 20 ? UNP P0A8T7 ? ? 'EXPRESSION TAG' 20 44 2 2LMC MET B 21 ? UNP P0A8T7 ? ? 'EXPRESSION TAG' 21 45 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.solution_id 1 _pdbx_nmr_exptl.type '2D 1H-15N HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.05 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '300 mM [U-100% 13C; U-100% 15N] Gp2-Jaw complex, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker DRX 1 'Bruker DRX' 800 Bruker DPX 2 'Bruker DPX' # _pdbx_nmr_refine.entry_id 2LMC _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LMC _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LMC _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA ? 1 ;Linge, O'Donoghue and Nilges ; refinement ARIA ? 2 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LMC _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LMC _struct.title 'Structure of T7 transcription factor Gp2-E. coli RNAp jaw domain complex' _struct.pdbx_descriptor 'Bacterial RNA polymerase inhibitor, DNA-directed RNA polymerase subunit beta (E.C.2.7.7.6)' _struct.pdbx_model_details 'minimized average structure, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 2LMC _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'TRANSFERASE, TRANSCRIPTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 55 ? GLN A 66 ? THR A 55 GLN A 66 1 ? 12 HELX_P HELX_P2 2 TYR A 67 ? GLY A 71 ? TYR A 67 GLY A 71 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 46 ? PRO A 50 ? SER A 46 PRO A 50 A 2 PHE A 36 ? GLU A 41 ? PHE A 36 GLU A 41 A 3 GLU A 73 ? PRO A 79 ? GLU A 73 PRO A 79 B 1 TYR B 57 ? PRO B 62 ? TYR B 57 PRO B 62 B 2 LYS B 43 ? THR B 49 ? LYS B 43 THR B 49 B 3 GLY B 32 ? GLY B 37 ? GLY B 32 GLY B 37 B 4 GLU B 73 ? VAL B 75 ? GLU B 73 VAL B 75 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 49 ? O VAL A 49 N ALA A 38 ? N ALA A 38 A 2 3 N GLU A 41 ? N GLU A 41 O GLU A 73 ? O GLU A 73 B 1 2 O GLU B 59 ? O GLU B 59 N LEU B 46 ? N LEU B 46 B 2 3 O THR B 49 ? O THR B 49 N ILE B 33 ? N ILE B 33 B 3 4 N GLY B 32 ? N GLY B 32 O VAL B 75 ? O VAL B 75 # _atom_sites.entry_id 2LMC _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 HIS 5 5 ? ? ? A . n A 1 6 HIS 6 6 ? ? ? A . n A 1 7 HIS 7 7 ? ? ? A . n A 1 8 HIS 8 8 ? ? ? A . n A 1 9 HIS 9 9 ? ? ? A . n A 1 10 HIS 10 10 ? ? ? A . n A 1 11 SER 11 11 ? ? ? A . n A 1 12 SER 12 12 ? ? ? A . n A 1 13 GLY 13 13 ? ? ? A . n A 1 14 LEU 14 14 ? ? ? A . n A 1 15 VAL 15 15 ? ? ? A . n A 1 16 PRO 16 16 ? ? ? A . n A 1 17 ARG 17 17 ? ? ? A . n A 1 18 GLY 18 18 ? ? ? A . n A 1 19 SER 19 19 ? ? ? A . n A 1 20 HIS 20 20 ? ? ? A . n A 1 21 MET 21 21 ? ? ? A . n A 1 22 SER 22 22 ? ? ? A . n A 1 23 ASN 23 23 ? ? ? A . n A 1 24 VAL 24 24 ? ? ? A . n A 1 25 ASN 25 25 ? ? ? A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 TRP 65 65 65 TRP TRP A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 CYS 80 80 80 CYS CYS A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 LYS 84 84 84 LYS LYS A . n B 2 1 MET 1 1 ? ? ? B . n B 2 2 GLY 2 2 ? ? ? B . n B 2 3 SER 3 3 ? ? ? B . n B 2 4 SER 4 4 ? ? ? B . n B 2 5 HIS 5 5 ? ? ? B . n B 2 6 HIS 6 6 ? ? ? B . n B 2 7 HIS 7 7 ? ? ? B . n B 2 8 HIS 8 8 ? ? ? B . n B 2 9 HIS 9 9 ? ? ? B . n B 2 10 HIS 10 10 ? ? ? B . n B 2 11 SER 11 11 ? ? ? B . n B 2 12 SER 12 12 ? ? ? B . n B 2 13 GLY 13 13 ? ? ? B . n B 2 14 LEU 14 14 ? ? ? B . n B 2 15 VAL 15 15 ? ? ? B . n B 2 16 PRO 16 16 ? ? ? B . n B 2 17 ARG 17 17 ? ? ? B . n B 2 18 GLY 18 18 ? ? ? B . n B 2 19 SER 19 19 ? ? ? B . n B 2 20 HIS 20 20 ? ? ? B . n B 2 21 MET 21 21 ? ? ? B . n B 2 22 LYS 22 22 ? ? ? B . n B 2 23 GLU 23 23 ? ? ? B . n B 2 24 PRO 24 24 24 PRO PRO B . n B 2 25 ALA 25 25 25 ALA ALA B . n B 2 26 ILE 26 26 26 ILE ILE B . n B 2 27 LEU 27 27 27 LEU LEU B . n B 2 28 ALA 28 28 28 ALA ALA B . n B 2 29 GLU 29 29 29 GLU GLU B . n B 2 30 ILE 30 30 30 ILE ILE B . n B 2 31 SER 31 31 31 SER SER B . n B 2 32 GLY 32 32 32 GLY GLY B . n B 2 33 ILE 33 33 33 ILE ILE B . n B 2 34 VAL 34 34 34 VAL VAL B . n B 2 35 SER 35 35 35 SER SER B . n B 2 36 PHE 36 36 36 PHE PHE B . n B 2 37 GLY 37 37 37 GLY GLY B . n B 2 38 LYS 38 38 38 LYS LYS B . n B 2 39 GLU 39 39 39 GLU GLU B . n B 2 40 THR 40 40 40 THR THR B . n B 2 41 LYS 41 41 41 LYS LYS B . n B 2 42 GLY 42 42 42 GLY GLY B . n B 2 43 LYS 43 43 43 LYS LYS B . n B 2 44 ARG 44 44 44 ARG ARG B . n B 2 45 ARG 45 45 45 ARG ARG B . n B 2 46 LEU 46 46 46 LEU LEU B . n B 2 47 VAL 47 47 47 VAL VAL B . n B 2 48 ILE 48 48 48 ILE ILE B . n B 2 49 THR 49 49 49 THR THR B . n B 2 50 PRO 50 50 50 PRO PRO B . n B 2 51 VAL 51 51 51 VAL VAL B . n B 2 52 ASP 52 52 52 ASP ASP B . n B 2 53 GLY 53 53 53 GLY GLY B . n B 2 54 SER 54 54 54 SER SER B . n B 2 55 ASP 55 55 55 ASP ASP B . n B 2 56 PRO 56 56 56 PRO PRO B . n B 2 57 TYR 57 57 57 TYR TYR B . n B 2 58 GLU 58 58 58 GLU GLU B . n B 2 59 GLU 59 59 59 GLU GLU B . n B 2 60 MET 60 60 60 MET MET B . n B 2 61 ILE 61 61 61 ILE ILE B . n B 2 62 PRO 62 62 62 PRO PRO B . n B 2 63 LYS 63 63 63 LYS LYS B . n B 2 64 TRP 64 64 64 TRP TRP B . n B 2 65 ARG 65 65 65 ARG ARG B . n B 2 66 GLN 66 66 66 GLN GLN B . n B 2 67 LEU 67 67 67 LEU LEU B . n B 2 68 ASN 68 68 68 ASN ASN B . n B 2 69 VAL 69 69 69 VAL VAL B . n B 2 70 PHE 70 70 70 PHE PHE B . n B 2 71 GLU 71 71 71 GLU GLU B . n B 2 72 GLY 72 72 72 GLY GLY B . n B 2 73 GLU 73 73 73 GLU GLU B . n B 2 74 ARG 74 74 74 ARG ARG B . n B 2 75 VAL 75 75 75 VAL VAL B . n B 2 76 GLU 76 76 76 GLU GLU B . n B 2 77 ARG 77 77 77 ARG ARG B . n B 2 78 GLY 78 78 78 GLY GLY B . n B 2 79 ASP 79 79 79 ASP ASP B . n B 2 80 VAL 80 80 80 VAL VAL B . n B 2 81 ILE 81 81 81 ILE ILE B . n B 2 82 SER 82 82 82 SER SER B . n B 2 83 ASP 83 83 83 ASP ASP B . n B 2 84 GLY 84 84 84 GLY GLY B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-03-14 2 'Structure model' 1 1 2012-08-01 3 'Structure model' 1 2 2012-10-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # _pdbx_nmr_exptl_sample.component 'Gp2-Jaw complex-1' _pdbx_nmr_exptl_sample.concentration 300 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-100% 13C; U-100% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 OE1 A GLU 64 ? ? HZ3 B LYS 38 ? ? 1.57 2 3 O A SER 30 ? ? H A ASP 32 ? ? 1.60 3 4 OD1 A ASP 57 ? ? HH21 B ARG 45 ? ? 1.59 4 7 HH B TYR 57 ? ? OE1 B GLU 59 ? ? 1.59 5 7 OE1 A GLU 64 ? ? HG1 B THR 40 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 28 ? ? 62.75 -148.43 2 1 LEU A 29 ? ? 62.94 93.70 3 1 SER A 30 ? ? -83.09 -76.27 4 1 SER A 42 ? ? -103.07 -162.94 5 1 GLU A 44 ? ? -138.06 -45.02 6 1 ALA A 82 ? ? 54.49 87.49 7 1 PRO A 83 ? ? -39.99 128.33 8 1 ALA B 25 ? ? -146.93 -87.80 9 1 LYS B 41 ? ? -142.94 -81.73 10 1 LYS B 43 ? ? -113.38 -163.60 11 1 VAL B 80 ? ? -154.02 -79.52 12 1 ILE B 81 ? ? -120.33 -50.24 13 2 SER A 30 ? ? -95.51 -142.93 14 2 ALA B 25 ? ? -119.56 -90.35 15 2 LYS B 41 ? ? 43.37 89.86 16 2 GLN B 66 ? ? -68.26 94.73 17 2 VAL B 80 ? ? -179.74 -63.71 18 2 ILE B 81 ? ? -120.60 -51.50 19 2 SER B 82 ? ? -170.52 117.90 20 3 VAL A 31 ? ? 60.51 -41.90 21 3 ASP A 32 ? ? 61.19 75.20 22 3 HIS A 45 ? ? -171.95 131.63 23 3 ALA B 25 ? ? -80.83 -145.96 24 3 THR B 40 ? ? -75.13 -89.04 25 3 VAL B 80 ? ? -175.43 -59.76 26 3 ILE B 81 ? ? -121.10 -51.30 27 4 SER A 28 ? ? -145.02 -85.79 28 4 SER A 30 ? ? -179.83 -155.55 29 4 THR A 75 ? ? -124.70 -58.99 30 4 VAL A 81 ? ? -105.23 -83.58 31 4 ALA B 25 ? ? -96.82 -154.16 32 4 THR B 40 ? ? -65.34 -82.22 33 4 LYS B 41 ? ? -129.05 -59.47 34 4 ASP B 52 ? ? -133.10 -67.96 35 4 VAL B 80 ? ? -171.41 -57.71 36 4 ILE B 81 ? ? -120.15 -51.48 37 5 SER A 30 ? ? -71.01 -70.78 38 5 SER A 42 ? ? -105.39 -161.21 39 5 ALA B 25 ? ? -94.04 -146.37 40 5 THR B 40 ? ? -66.89 -78.99 41 5 LYS B 41 ? ? -138.25 -66.28 42 5 VAL B 80 ? ? -174.52 -61.79 43 6 CYS A 80 ? ? -66.78 89.80 44 6 ALA B 25 ? ? -113.40 -130.38 45 6 THR B 40 ? ? -70.04 -85.23 46 6 LYS B 41 ? ? -130.93 -73.15 47 6 ARG B 44 ? ? -160.70 118.66 48 6 ASP B 52 ? ? -102.43 -64.05 49 6 VAL B 80 ? ? -176.06 -65.68 50 6 ILE B 81 ? ? -121.17 -52.08 51 7 SER A 28 ? ? -154.44 -80.64 52 7 SER A 30 ? ? -109.59 -63.27 53 7 SER A 42 ? ? -85.55 -159.92 54 7 GLU A 44 ? ? -139.85 -49.41 55 7 ALA B 25 ? ? -135.75 -92.95 56 7 ILE B 26 ? ? -115.46 77.09 57 7 LYS B 41 ? ? -159.65 -53.02 58 7 VAL B 80 ? ? -175.69 -61.58 59 7 ILE B 81 ? ? -121.97 -52.09 60 8 SER A 28 ? ? -148.92 -85.12 61 8 SER A 30 ? ? -102.26 -62.13 62 8 ALA B 25 ? ? -98.06 -143.18 63 8 THR B 40 ? ? -58.02 -78.98 64 8 LYS B 41 ? ? -160.84 -37.78 65 8 ARG B 44 ? ? -160.49 109.20 66 8 VAL B 80 ? ? -174.98 -58.04 67 8 ILE B 81 ? ? -121.08 -52.99 68 8 SER B 82 ? ? -173.16 139.99 69 9 VAL A 31 ? ? -167.13 -38.36 70 9 ASP A 32 ? ? 64.18 74.55 71 9 THR A 75 ? ? -120.82 -54.12 72 9 ALA B 25 ? ? -129.40 -91.01 73 9 GLN B 66 ? ? -68.05 99.52 74 9 VAL B 80 ? ? -176.55 -52.67 75 9 SER B 82 ? ? -163.25 111.44 76 10 SER A 30 ? ? -173.97 -163.56 77 10 GLU A 44 ? ? -130.02 -61.52 78 10 ALA B 25 ? ? -130.02 -141.49 79 10 THR B 40 ? ? -56.78 -75.19 80 10 LYS B 41 ? ? -141.71 -65.56 81 10 SER B 54 ? ? -105.28 47.25 82 10 VAL B 80 ? ? -173.09 -63.79 83 10 ILE B 81 ? ? -120.82 -51.39 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A HIS 5 ? A HIS 5 6 1 Y 1 A HIS 6 ? A HIS 6 7 1 Y 1 A HIS 7 ? A HIS 7 8 1 Y 1 A HIS 8 ? A HIS 8 9 1 Y 1 A HIS 9 ? A HIS 9 10 1 Y 1 A HIS 10 ? A HIS 10 11 1 Y 1 A SER 11 ? A SER 11 12 1 Y 1 A SER 12 ? A SER 12 13 1 Y 1 A GLY 13 ? A GLY 13 14 1 Y 1 A LEU 14 ? A LEU 14 15 1 Y 1 A VAL 15 ? A VAL 15 16 1 Y 1 A PRO 16 ? A PRO 16 17 1 Y 1 A ARG 17 ? A ARG 17 18 1 Y 1 A GLY 18 ? A GLY 18 19 1 Y 1 A SER 19 ? A SER 19 20 1 Y 1 A HIS 20 ? A HIS 20 21 1 Y 1 A MET 21 ? A MET 21 22 1 Y 1 A SER 22 ? A SER 22 23 1 Y 1 A ASN 23 ? A ASN 23 24 1 Y 1 A VAL 24 ? A VAL 24 25 1 Y 1 A ASN 25 ? A ASN 25 26 1 Y 1 B MET 1 ? B MET 1 27 1 Y 1 B GLY 2 ? B GLY 2 28 1 Y 1 B SER 3 ? B SER 3 29 1 Y 1 B SER 4 ? B SER 4 30 1 Y 1 B HIS 5 ? B HIS 5 31 1 Y 1 B HIS 6 ? B HIS 6 32 1 Y 1 B HIS 7 ? B HIS 7 33 1 Y 1 B HIS 8 ? B HIS 8 34 1 Y 1 B HIS 9 ? B HIS 9 35 1 Y 1 B HIS 10 ? B HIS 10 36 1 Y 1 B SER 11 ? B SER 11 37 1 Y 1 B SER 12 ? B SER 12 38 1 Y 1 B GLY 13 ? B GLY 13 39 1 Y 1 B LEU 14 ? B LEU 14 40 1 Y 1 B VAL 15 ? B VAL 15 41 1 Y 1 B PRO 16 ? B PRO 16 42 1 Y 1 B ARG 17 ? B ARG 17 43 1 Y 1 B GLY 18 ? B GLY 18 44 1 Y 1 B SER 19 ? B SER 19 45 1 Y 1 B HIS 20 ? B HIS 20 46 1 Y 1 B MET 21 ? B MET 21 47 1 Y 1 B LYS 22 ? B LYS 22 48 1 Y 1 B GLU 23 ? B GLU 23 49 2 Y 1 A MET 1 ? A MET 1 50 2 Y 1 A GLY 2 ? A GLY 2 51 2 Y 1 A SER 3 ? A SER 3 52 2 Y 1 A SER 4 ? A SER 4 53 2 Y 1 A HIS 5 ? A HIS 5 54 2 Y 1 A HIS 6 ? A HIS 6 55 2 Y 1 A HIS 7 ? A HIS 7 56 2 Y 1 A HIS 8 ? A HIS 8 57 2 Y 1 A HIS 9 ? A HIS 9 58 2 Y 1 A HIS 10 ? A HIS 10 59 2 Y 1 A SER 11 ? A SER 11 60 2 Y 1 A SER 12 ? A SER 12 61 2 Y 1 A GLY 13 ? A GLY 13 62 2 Y 1 A LEU 14 ? A LEU 14 63 2 Y 1 A VAL 15 ? A VAL 15 64 2 Y 1 A PRO 16 ? A PRO 16 65 2 Y 1 A ARG 17 ? A ARG 17 66 2 Y 1 A GLY 18 ? A GLY 18 67 2 Y 1 A SER 19 ? A SER 19 68 2 Y 1 A HIS 20 ? A HIS 20 69 2 Y 1 A MET 21 ? A MET 21 70 2 Y 1 A SER 22 ? A SER 22 71 2 Y 1 A ASN 23 ? A ASN 23 72 2 Y 1 A VAL 24 ? A VAL 24 73 2 Y 1 A ASN 25 ? A ASN 25 74 2 Y 1 B MET 1 ? B MET 1 75 2 Y 1 B GLY 2 ? B GLY 2 76 2 Y 1 B SER 3 ? B SER 3 77 2 Y 1 B SER 4 ? B SER 4 78 2 Y 1 B HIS 5 ? B HIS 5 79 2 Y 1 B HIS 6 ? B HIS 6 80 2 Y 1 B HIS 7 ? B HIS 7 81 2 Y 1 B HIS 8 ? B HIS 8 82 2 Y 1 B HIS 9 ? B HIS 9 83 2 Y 1 B HIS 10 ? B HIS 10 84 2 Y 1 B SER 11 ? B SER 11 85 2 Y 1 B SER 12 ? B SER 12 86 2 Y 1 B GLY 13 ? B GLY 13 87 2 Y 1 B LEU 14 ? B LEU 14 88 2 Y 1 B VAL 15 ? B VAL 15 89 2 Y 1 B PRO 16 ? B PRO 16 90 2 Y 1 B ARG 17 ? B ARG 17 91 2 Y 1 B GLY 18 ? B GLY 18 92 2 Y 1 B SER 19 ? B SER 19 93 2 Y 1 B HIS 20 ? B HIS 20 94 2 Y 1 B MET 21 ? B MET 21 95 2 Y 1 B LYS 22 ? B LYS 22 96 2 Y 1 B GLU 23 ? B GLU 23 97 3 Y 1 A MET 1 ? A MET 1 98 3 Y 1 A GLY 2 ? A GLY 2 99 3 Y 1 A SER 3 ? A SER 3 100 3 Y 1 A SER 4 ? A SER 4 101 3 Y 1 A HIS 5 ? A HIS 5 102 3 Y 1 A HIS 6 ? A HIS 6 103 3 Y 1 A HIS 7 ? A HIS 7 104 3 Y 1 A HIS 8 ? A HIS 8 105 3 Y 1 A HIS 9 ? A HIS 9 106 3 Y 1 A HIS 10 ? A HIS 10 107 3 Y 1 A SER 11 ? A SER 11 108 3 Y 1 A SER 12 ? A SER 12 109 3 Y 1 A GLY 13 ? A GLY 13 110 3 Y 1 A LEU 14 ? A LEU 14 111 3 Y 1 A VAL 15 ? A VAL 15 112 3 Y 1 A PRO 16 ? A PRO 16 113 3 Y 1 A ARG 17 ? A ARG 17 114 3 Y 1 A GLY 18 ? A GLY 18 115 3 Y 1 A SER 19 ? A SER 19 116 3 Y 1 A HIS 20 ? A HIS 20 117 3 Y 1 A MET 21 ? A MET 21 118 3 Y 1 A SER 22 ? A SER 22 119 3 Y 1 A ASN 23 ? A ASN 23 120 3 Y 1 A VAL 24 ? A VAL 24 121 3 Y 1 A ASN 25 ? A ASN 25 122 3 Y 1 B MET 1 ? B MET 1 123 3 Y 1 B GLY 2 ? B GLY 2 124 3 Y 1 B SER 3 ? B SER 3 125 3 Y 1 B SER 4 ? B SER 4 126 3 Y 1 B HIS 5 ? B HIS 5 127 3 Y 1 B HIS 6 ? B HIS 6 128 3 Y 1 B HIS 7 ? B HIS 7 129 3 Y 1 B HIS 8 ? B HIS 8 130 3 Y 1 B HIS 9 ? B HIS 9 131 3 Y 1 B HIS 10 ? B HIS 10 132 3 Y 1 B SER 11 ? B SER 11 133 3 Y 1 B SER 12 ? B SER 12 134 3 Y 1 B GLY 13 ? B GLY 13 135 3 Y 1 B LEU 14 ? B LEU 14 136 3 Y 1 B VAL 15 ? B VAL 15 137 3 Y 1 B PRO 16 ? B PRO 16 138 3 Y 1 B ARG 17 ? B ARG 17 139 3 Y 1 B GLY 18 ? B GLY 18 140 3 Y 1 B SER 19 ? B SER 19 141 3 Y 1 B HIS 20 ? B HIS 20 142 3 Y 1 B MET 21 ? B MET 21 143 3 Y 1 B LYS 22 ? B LYS 22 144 3 Y 1 B GLU 23 ? B GLU 23 145 4 Y 1 A MET 1 ? A MET 1 146 4 Y 1 A GLY 2 ? A GLY 2 147 4 Y 1 A SER 3 ? A SER 3 148 4 Y 1 A SER 4 ? A SER 4 149 4 Y 1 A HIS 5 ? A HIS 5 150 4 Y 1 A HIS 6 ? A HIS 6 151 4 Y 1 A HIS 7 ? A HIS 7 152 4 Y 1 A HIS 8 ? A HIS 8 153 4 Y 1 A HIS 9 ? A HIS 9 154 4 Y 1 A HIS 10 ? A HIS 10 155 4 Y 1 A SER 11 ? A SER 11 156 4 Y 1 A SER 12 ? A SER 12 157 4 Y 1 A GLY 13 ? A GLY 13 158 4 Y 1 A LEU 14 ? A LEU 14 159 4 Y 1 A VAL 15 ? A VAL 15 160 4 Y 1 A PRO 16 ? A PRO 16 161 4 Y 1 A ARG 17 ? A ARG 17 162 4 Y 1 A GLY 18 ? A GLY 18 163 4 Y 1 A SER 19 ? A SER 19 164 4 Y 1 A HIS 20 ? A HIS 20 165 4 Y 1 A MET 21 ? A MET 21 166 4 Y 1 A SER 22 ? A SER 22 167 4 Y 1 A ASN 23 ? A ASN 23 168 4 Y 1 A VAL 24 ? A VAL 24 169 4 Y 1 A ASN 25 ? A ASN 25 170 4 Y 1 B MET 1 ? B MET 1 171 4 Y 1 B GLY 2 ? B GLY 2 172 4 Y 1 B SER 3 ? B SER 3 173 4 Y 1 B SER 4 ? B SER 4 174 4 Y 1 B HIS 5 ? B HIS 5 175 4 Y 1 B HIS 6 ? B HIS 6 176 4 Y 1 B HIS 7 ? B HIS 7 177 4 Y 1 B HIS 8 ? B HIS 8 178 4 Y 1 B HIS 9 ? B HIS 9 179 4 Y 1 B HIS 10 ? B HIS 10 180 4 Y 1 B SER 11 ? B SER 11 181 4 Y 1 B SER 12 ? B SER 12 182 4 Y 1 B GLY 13 ? B GLY 13 183 4 Y 1 B LEU 14 ? B LEU 14 184 4 Y 1 B VAL 15 ? B VAL 15 185 4 Y 1 B PRO 16 ? B PRO 16 186 4 Y 1 B ARG 17 ? B ARG 17 187 4 Y 1 B GLY 18 ? B GLY 18 188 4 Y 1 B SER 19 ? B SER 19 189 4 Y 1 B HIS 20 ? B HIS 20 190 4 Y 1 B MET 21 ? B MET 21 191 4 Y 1 B LYS 22 ? B LYS 22 192 4 Y 1 B GLU 23 ? B GLU 23 193 5 Y 1 A MET 1 ? A MET 1 194 5 Y 1 A GLY 2 ? A GLY 2 195 5 Y 1 A SER 3 ? A SER 3 196 5 Y 1 A SER 4 ? A SER 4 197 5 Y 1 A HIS 5 ? A HIS 5 198 5 Y 1 A HIS 6 ? A HIS 6 199 5 Y 1 A HIS 7 ? A HIS 7 200 5 Y 1 A HIS 8 ? A HIS 8 201 5 Y 1 A HIS 9 ? A HIS 9 202 5 Y 1 A HIS 10 ? A HIS 10 203 5 Y 1 A SER 11 ? A SER 11 204 5 Y 1 A SER 12 ? A SER 12 205 5 Y 1 A GLY 13 ? A GLY 13 206 5 Y 1 A LEU 14 ? A LEU 14 207 5 Y 1 A VAL 15 ? A VAL 15 208 5 Y 1 A PRO 16 ? A PRO 16 209 5 Y 1 A ARG 17 ? A ARG 17 210 5 Y 1 A GLY 18 ? A GLY 18 211 5 Y 1 A SER 19 ? A SER 19 212 5 Y 1 A HIS 20 ? A HIS 20 213 5 Y 1 A MET 21 ? A MET 21 214 5 Y 1 A SER 22 ? A SER 22 215 5 Y 1 A ASN 23 ? A ASN 23 216 5 Y 1 A VAL 24 ? A VAL 24 217 5 Y 1 A ASN 25 ? A ASN 25 218 5 Y 1 B MET 1 ? B MET 1 219 5 Y 1 B GLY 2 ? B GLY 2 220 5 Y 1 B SER 3 ? B SER 3 221 5 Y 1 B SER 4 ? B SER 4 222 5 Y 1 B HIS 5 ? B HIS 5 223 5 Y 1 B HIS 6 ? B HIS 6 224 5 Y 1 B HIS 7 ? B HIS 7 225 5 Y 1 B HIS 8 ? B HIS 8 226 5 Y 1 B HIS 9 ? B HIS 9 227 5 Y 1 B HIS 10 ? B HIS 10 228 5 Y 1 B SER 11 ? B SER 11 229 5 Y 1 B SER 12 ? B SER 12 230 5 Y 1 B GLY 13 ? B GLY 13 231 5 Y 1 B LEU 14 ? B LEU 14 232 5 Y 1 B VAL 15 ? B VAL 15 233 5 Y 1 B PRO 16 ? B PRO 16 234 5 Y 1 B ARG 17 ? B ARG 17 235 5 Y 1 B GLY 18 ? B GLY 18 236 5 Y 1 B SER 19 ? B SER 19 237 5 Y 1 B HIS 20 ? B HIS 20 238 5 Y 1 B MET 21 ? B MET 21 239 5 Y 1 B LYS 22 ? B LYS 22 240 5 Y 1 B GLU 23 ? B GLU 23 241 6 Y 1 A MET 1 ? A MET 1 242 6 Y 1 A GLY 2 ? A GLY 2 243 6 Y 1 A SER 3 ? A SER 3 244 6 Y 1 A SER 4 ? A SER 4 245 6 Y 1 A HIS 5 ? A HIS 5 246 6 Y 1 A HIS 6 ? A HIS 6 247 6 Y 1 A HIS 7 ? A HIS 7 248 6 Y 1 A HIS 8 ? A HIS 8 249 6 Y 1 A HIS 9 ? A HIS 9 250 6 Y 1 A HIS 10 ? A HIS 10 251 6 Y 1 A SER 11 ? A SER 11 252 6 Y 1 A SER 12 ? A SER 12 253 6 Y 1 A GLY 13 ? A GLY 13 254 6 Y 1 A LEU 14 ? A LEU 14 255 6 Y 1 A VAL 15 ? A VAL 15 256 6 Y 1 A PRO 16 ? A PRO 16 257 6 Y 1 A ARG 17 ? A ARG 17 258 6 Y 1 A GLY 18 ? A GLY 18 259 6 Y 1 A SER 19 ? A SER 19 260 6 Y 1 A HIS 20 ? A HIS 20 261 6 Y 1 A MET 21 ? A MET 21 262 6 Y 1 A SER 22 ? A SER 22 263 6 Y 1 A ASN 23 ? A ASN 23 264 6 Y 1 A VAL 24 ? A VAL 24 265 6 Y 1 A ASN 25 ? A ASN 25 266 6 Y 1 B MET 1 ? B MET 1 267 6 Y 1 B GLY 2 ? B GLY 2 268 6 Y 1 B SER 3 ? B SER 3 269 6 Y 1 B SER 4 ? B SER 4 270 6 Y 1 B HIS 5 ? B HIS 5 271 6 Y 1 B HIS 6 ? B HIS 6 272 6 Y 1 B HIS 7 ? B HIS 7 273 6 Y 1 B HIS 8 ? B HIS 8 274 6 Y 1 B HIS 9 ? B HIS 9 275 6 Y 1 B HIS 10 ? B HIS 10 276 6 Y 1 B SER 11 ? B SER 11 277 6 Y 1 B SER 12 ? B SER 12 278 6 Y 1 B GLY 13 ? B GLY 13 279 6 Y 1 B LEU 14 ? B LEU 14 280 6 Y 1 B VAL 15 ? B VAL 15 281 6 Y 1 B PRO 16 ? B PRO 16 282 6 Y 1 B ARG 17 ? B ARG 17 283 6 Y 1 B GLY 18 ? B GLY 18 284 6 Y 1 B SER 19 ? B SER 19 285 6 Y 1 B HIS 20 ? B HIS 20 286 6 Y 1 B MET 21 ? B MET 21 287 6 Y 1 B LYS 22 ? B LYS 22 288 6 Y 1 B GLU 23 ? B GLU 23 289 7 Y 1 A MET 1 ? A MET 1 290 7 Y 1 A GLY 2 ? A GLY 2 291 7 Y 1 A SER 3 ? A SER 3 292 7 Y 1 A SER 4 ? A SER 4 293 7 Y 1 A HIS 5 ? A HIS 5 294 7 Y 1 A HIS 6 ? A HIS 6 295 7 Y 1 A HIS 7 ? A HIS 7 296 7 Y 1 A HIS 8 ? A HIS 8 297 7 Y 1 A HIS 9 ? A HIS 9 298 7 Y 1 A HIS 10 ? A HIS 10 299 7 Y 1 A SER 11 ? A SER 11 300 7 Y 1 A SER 12 ? A SER 12 301 7 Y 1 A GLY 13 ? A GLY 13 302 7 Y 1 A LEU 14 ? A LEU 14 303 7 Y 1 A VAL 15 ? A VAL 15 304 7 Y 1 A PRO 16 ? A PRO 16 305 7 Y 1 A ARG 17 ? A ARG 17 306 7 Y 1 A GLY 18 ? A GLY 18 307 7 Y 1 A SER 19 ? A SER 19 308 7 Y 1 A HIS 20 ? A HIS 20 309 7 Y 1 A MET 21 ? A MET 21 310 7 Y 1 A SER 22 ? A SER 22 311 7 Y 1 A ASN 23 ? A ASN 23 312 7 Y 1 A VAL 24 ? A VAL 24 313 7 Y 1 A ASN 25 ? A ASN 25 314 7 Y 1 B MET 1 ? B MET 1 315 7 Y 1 B GLY 2 ? B GLY 2 316 7 Y 1 B SER 3 ? B SER 3 317 7 Y 1 B SER 4 ? B SER 4 318 7 Y 1 B HIS 5 ? B HIS 5 319 7 Y 1 B HIS 6 ? B HIS 6 320 7 Y 1 B HIS 7 ? B HIS 7 321 7 Y 1 B HIS 8 ? B HIS 8 322 7 Y 1 B HIS 9 ? B HIS 9 323 7 Y 1 B HIS 10 ? B HIS 10 324 7 Y 1 B SER 11 ? B SER 11 325 7 Y 1 B SER 12 ? B SER 12 326 7 Y 1 B GLY 13 ? B GLY 13 327 7 Y 1 B LEU 14 ? B LEU 14 328 7 Y 1 B VAL 15 ? B VAL 15 329 7 Y 1 B PRO 16 ? B PRO 16 330 7 Y 1 B ARG 17 ? B ARG 17 331 7 Y 1 B GLY 18 ? B GLY 18 332 7 Y 1 B SER 19 ? B SER 19 333 7 Y 1 B HIS 20 ? B HIS 20 334 7 Y 1 B MET 21 ? B MET 21 335 7 Y 1 B LYS 22 ? B LYS 22 336 7 Y 1 B GLU 23 ? B GLU 23 337 8 Y 1 A MET 1 ? A MET 1 338 8 Y 1 A GLY 2 ? A GLY 2 339 8 Y 1 A SER 3 ? A SER 3 340 8 Y 1 A SER 4 ? A SER 4 341 8 Y 1 A HIS 5 ? A HIS 5 342 8 Y 1 A HIS 6 ? A HIS 6 343 8 Y 1 A HIS 7 ? A HIS 7 344 8 Y 1 A HIS 8 ? A HIS 8 345 8 Y 1 A HIS 9 ? A HIS 9 346 8 Y 1 A HIS 10 ? A HIS 10 347 8 Y 1 A SER 11 ? A SER 11 348 8 Y 1 A SER 12 ? A SER 12 349 8 Y 1 A GLY 13 ? A GLY 13 350 8 Y 1 A LEU 14 ? A LEU 14 351 8 Y 1 A VAL 15 ? A VAL 15 352 8 Y 1 A PRO 16 ? A PRO 16 353 8 Y 1 A ARG 17 ? A ARG 17 354 8 Y 1 A GLY 18 ? A GLY 18 355 8 Y 1 A SER 19 ? A SER 19 356 8 Y 1 A HIS 20 ? A HIS 20 357 8 Y 1 A MET 21 ? A MET 21 358 8 Y 1 A SER 22 ? A SER 22 359 8 Y 1 A ASN 23 ? A ASN 23 360 8 Y 1 A VAL 24 ? A VAL 24 361 8 Y 1 A ASN 25 ? A ASN 25 362 8 Y 1 B MET 1 ? B MET 1 363 8 Y 1 B GLY 2 ? B GLY 2 364 8 Y 1 B SER 3 ? B SER 3 365 8 Y 1 B SER 4 ? B SER 4 366 8 Y 1 B HIS 5 ? B HIS 5 367 8 Y 1 B HIS 6 ? B HIS 6 368 8 Y 1 B HIS 7 ? B HIS 7 369 8 Y 1 B HIS 8 ? B HIS 8 370 8 Y 1 B HIS 9 ? B HIS 9 371 8 Y 1 B HIS 10 ? B HIS 10 372 8 Y 1 B SER 11 ? B SER 11 373 8 Y 1 B SER 12 ? B SER 12 374 8 Y 1 B GLY 13 ? B GLY 13 375 8 Y 1 B LEU 14 ? B LEU 14 376 8 Y 1 B VAL 15 ? B VAL 15 377 8 Y 1 B PRO 16 ? B PRO 16 378 8 Y 1 B ARG 17 ? B ARG 17 379 8 Y 1 B GLY 18 ? B GLY 18 380 8 Y 1 B SER 19 ? B SER 19 381 8 Y 1 B HIS 20 ? B HIS 20 382 8 Y 1 B MET 21 ? B MET 21 383 8 Y 1 B LYS 22 ? B LYS 22 384 8 Y 1 B GLU 23 ? B GLU 23 385 9 Y 1 A MET 1 ? A MET 1 386 9 Y 1 A GLY 2 ? A GLY 2 387 9 Y 1 A SER 3 ? A SER 3 388 9 Y 1 A SER 4 ? A SER 4 389 9 Y 1 A HIS 5 ? A HIS 5 390 9 Y 1 A HIS 6 ? A HIS 6 391 9 Y 1 A HIS 7 ? A HIS 7 392 9 Y 1 A HIS 8 ? A HIS 8 393 9 Y 1 A HIS 9 ? A HIS 9 394 9 Y 1 A HIS 10 ? A HIS 10 395 9 Y 1 A SER 11 ? A SER 11 396 9 Y 1 A SER 12 ? A SER 12 397 9 Y 1 A GLY 13 ? A GLY 13 398 9 Y 1 A LEU 14 ? A LEU 14 399 9 Y 1 A VAL 15 ? A VAL 15 400 9 Y 1 A PRO 16 ? A PRO 16 401 9 Y 1 A ARG 17 ? A ARG 17 402 9 Y 1 A GLY 18 ? A GLY 18 403 9 Y 1 A SER 19 ? A SER 19 404 9 Y 1 A HIS 20 ? A HIS 20 405 9 Y 1 A MET 21 ? A MET 21 406 9 Y 1 A SER 22 ? A SER 22 407 9 Y 1 A ASN 23 ? A ASN 23 408 9 Y 1 A VAL 24 ? A VAL 24 409 9 Y 1 A ASN 25 ? A ASN 25 410 9 Y 1 B MET 1 ? B MET 1 411 9 Y 1 B GLY 2 ? B GLY 2 412 9 Y 1 B SER 3 ? B SER 3 413 9 Y 1 B SER 4 ? B SER 4 414 9 Y 1 B HIS 5 ? B HIS 5 415 9 Y 1 B HIS 6 ? B HIS 6 416 9 Y 1 B HIS 7 ? B HIS 7 417 9 Y 1 B HIS 8 ? B HIS 8 418 9 Y 1 B HIS 9 ? B HIS 9 419 9 Y 1 B HIS 10 ? B HIS 10 420 9 Y 1 B SER 11 ? B SER 11 421 9 Y 1 B SER 12 ? B SER 12 422 9 Y 1 B GLY 13 ? B GLY 13 423 9 Y 1 B LEU 14 ? B LEU 14 424 9 Y 1 B VAL 15 ? B VAL 15 425 9 Y 1 B PRO 16 ? B PRO 16 426 9 Y 1 B ARG 17 ? B ARG 17 427 9 Y 1 B GLY 18 ? B GLY 18 428 9 Y 1 B SER 19 ? B SER 19 429 9 Y 1 B HIS 20 ? B HIS 20 430 9 Y 1 B MET 21 ? B MET 21 431 9 Y 1 B LYS 22 ? B LYS 22 432 9 Y 1 B GLU 23 ? B GLU 23 433 10 Y 1 A MET 1 ? A MET 1 434 10 Y 1 A GLY 2 ? A GLY 2 435 10 Y 1 A SER 3 ? A SER 3 436 10 Y 1 A SER 4 ? A SER 4 437 10 Y 1 A HIS 5 ? A HIS 5 438 10 Y 1 A HIS 6 ? A HIS 6 439 10 Y 1 A HIS 7 ? A HIS 7 440 10 Y 1 A HIS 8 ? A HIS 8 441 10 Y 1 A HIS 9 ? A HIS 9 442 10 Y 1 A HIS 10 ? A HIS 10 443 10 Y 1 A SER 11 ? A SER 11 444 10 Y 1 A SER 12 ? A SER 12 445 10 Y 1 A GLY 13 ? A GLY 13 446 10 Y 1 A LEU 14 ? A LEU 14 447 10 Y 1 A VAL 15 ? A VAL 15 448 10 Y 1 A PRO 16 ? A PRO 16 449 10 Y 1 A ARG 17 ? A ARG 17 450 10 Y 1 A GLY 18 ? A GLY 18 451 10 Y 1 A SER 19 ? A SER 19 452 10 Y 1 A HIS 20 ? A HIS 20 453 10 Y 1 A MET 21 ? A MET 21 454 10 Y 1 A SER 22 ? A SER 22 455 10 Y 1 A ASN 23 ? A ASN 23 456 10 Y 1 A VAL 24 ? A VAL 24 457 10 Y 1 A ASN 25 ? A ASN 25 458 10 Y 1 B MET 1 ? B MET 1 459 10 Y 1 B GLY 2 ? B GLY 2 460 10 Y 1 B SER 3 ? B SER 3 461 10 Y 1 B SER 4 ? B SER 4 462 10 Y 1 B HIS 5 ? B HIS 5 463 10 Y 1 B HIS 6 ? B HIS 6 464 10 Y 1 B HIS 7 ? B HIS 7 465 10 Y 1 B HIS 8 ? B HIS 8 466 10 Y 1 B HIS 9 ? B HIS 9 467 10 Y 1 B HIS 10 ? B HIS 10 468 10 Y 1 B SER 11 ? B SER 11 469 10 Y 1 B SER 12 ? B SER 12 470 10 Y 1 B GLY 13 ? B GLY 13 471 10 Y 1 B LEU 14 ? B LEU 14 472 10 Y 1 B VAL 15 ? B VAL 15 473 10 Y 1 B PRO 16 ? B PRO 16 474 10 Y 1 B ARG 17 ? B ARG 17 475 10 Y 1 B GLY 18 ? B GLY 18 476 10 Y 1 B SER 19 ? B SER 19 477 10 Y 1 B HIS 20 ? B HIS 20 478 10 Y 1 B MET 21 ? B MET 21 479 10 Y 1 B LYS 22 ? B LYS 22 480 10 Y 1 B GLU 23 ? B GLU 23 #