data_2LPV # _entry.id 2LPV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LPV pdb_00002lpv 10.2210/pdb2lpv/pdb RCSB RCSB102683 ? ? BMRB 18278 ? ? WWPDB D_1000102683 ? ? # _pdbx_database_related.db_id 18278 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LPV _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2012-02-20 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chakraborty, G.' 1 'Shin, J.' 2 # _citation.id primary _citation.title 'Solution structure of FK506-binding protein 12 from Aedes aegypti.' _citation.journal_abbrev Proteins _citation.journal_volume 80 _citation.page_first 2476 _citation.page_last 2481 _citation.year 2012 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22806993 _citation.pdbx_database_id_DOI 10.1002/prot.24146 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chakraborty, G.' 1 ? primary 'Shin, J.' 2 ? primary 'Nguyen, Q.T.' 3 ? primary 'Harikishore, A.' 4 ? primary 'Baek, K.' 5 ? primary 'Yoon, H.S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'FKBP-type peptidyl-prolyl cis-trans isomerase' _entity.formula_weight 11553.063 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Fk506-binding protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGVQVVTLAAGDEATYPKAGQVAVVHYTGTLADGKVFDSSRTRGKPFRFTVGRGEVIRGWDEGVAQMSVGQRAKLVCSPD YAYGSRGHPGVIPPNATLTFDVELLRVE ; _entity_poly.pdbx_seq_one_letter_code_can ;MGVQVVTLAAGDEATYPKAGQVAVVHYTGTLADGKVFDSSRTRGKPFRFTVGRGEVIRGWDEGVAQMSVGQRAKLVCSPD YAYGSRGHPGVIPPNATLTFDVELLRVE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 VAL n 1 4 GLN n 1 5 VAL n 1 6 VAL n 1 7 THR n 1 8 LEU n 1 9 ALA n 1 10 ALA n 1 11 GLY n 1 12 ASP n 1 13 GLU n 1 14 ALA n 1 15 THR n 1 16 TYR n 1 17 PRO n 1 18 LYS n 1 19 ALA n 1 20 GLY n 1 21 GLN n 1 22 VAL n 1 23 ALA n 1 24 VAL n 1 25 VAL n 1 26 HIS n 1 27 TYR n 1 28 THR n 1 29 GLY n 1 30 THR n 1 31 LEU n 1 32 ALA n 1 33 ASP n 1 34 GLY n 1 35 LYS n 1 36 VAL n 1 37 PHE n 1 38 ASP n 1 39 SER n 1 40 SER n 1 41 ARG n 1 42 THR n 1 43 ARG n 1 44 GLY n 1 45 LYS n 1 46 PRO n 1 47 PHE n 1 48 ARG n 1 49 PHE n 1 50 THR n 1 51 VAL n 1 52 GLY n 1 53 ARG n 1 54 GLY n 1 55 GLU n 1 56 VAL n 1 57 ILE n 1 58 ARG n 1 59 GLY n 1 60 TRP n 1 61 ASP n 1 62 GLU n 1 63 GLY n 1 64 VAL n 1 65 ALA n 1 66 GLN n 1 67 MET n 1 68 SER n 1 69 VAL n 1 70 GLY n 1 71 GLN n 1 72 ARG n 1 73 ALA n 1 74 LYS n 1 75 LEU n 1 76 VAL n 1 77 CYS n 1 78 SER n 1 79 PRO n 1 80 ASP n 1 81 TYR n 1 82 ALA n 1 83 TYR n 1 84 GLY n 1 85 SER n 1 86 ARG n 1 87 GLY n 1 88 HIS n 1 89 PRO n 1 90 GLY n 1 91 VAL n 1 92 ILE n 1 93 PRO n 1 94 PRO n 1 95 ASN n 1 96 ALA n 1 97 THR n 1 98 LEU n 1 99 THR n 1 100 PHE n 1 101 ASP n 1 102 VAL n 1 103 GLU n 1 104 LEU n 1 105 LEU n 1 106 ARG n 1 107 VAL n 1 108 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Yellowfever mosquito' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'AAEL007883, AaeL_AAEL007883' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Aedes aegypti' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7159 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET-SUMO _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q1HR83_AEDAE _struct_ref.pdbx_db_accession Q1HR83 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MGVQVVTLAAGDEATYPKAGQVAVVHYTGTLADGKVFDSSRTRGKPFRFTVGRGEVIRGWDEGVAQMSVGQRAKLVCSPD YAYGSRGHPGVIPPNATLTFDVELLRVE ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LPV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 108 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q1HR83 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 108 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 108 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '3D HNCACB' 1 3 2 '3D CBCA(CO)NH' 1 4 2 '3D HNCA' 1 5 2 '3D HN(CO)CA' 1 6 2 '3D HNCO' 1 7 2 '3D HN(CA)CO' 1 8 2 '3D C(CO)NH' 1 9 2 '3D H(CCO)NH' 1 10 1 '3D HNHA' 1 11 1 '3D 1H-15N NOESY' 1 12 3 '3D HCCH-TOCSY' 1 13 3 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.5 mM [U-15N] FKBP12-1, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.5 mM [U-100% 13C; U-100% 15N] FKBP12-2, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' '0.5 mM [U-100% 13C; U-100% 15N] FKBP12-3, 100% D2O' 3 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 700 Bruker AVANCE 1 'Bruker Avance' 600 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2LPV _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LPV _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LPV _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Bruker Biospin' collection TopSpin 1 ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 2 ? Goddard 'data analysis' Sparky 3 ? Goddard 'chemical shift assignment' Sparky 4 ? Goddard 'peak picking' Sparky 5 ? 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 6 ? 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 7 ? 'Koradi, Billeter and Wuthrich' 'structure visualization' MOLMOL 8 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LPV _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LPV _struct.title 'Solution Structure of FKBP12 from Aedes aegypti' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LPV _struct_keywords.pdbx_keywords ISOMERASE _struct_keywords.text 'FKBP12, ISOMERASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 41 ? GLY A 44 ? ARG A 41 GLY A 44 5 ? 4 HELX_P HELX_P2 2 ILE A 57 ? GLN A 66 ? ILE A 57 GLN A 66 1 ? 10 HELX_P HELX_P3 3 PRO A 79 ? ALA A 82 ? PRO A 79 ALA A 82 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 3 ? ALA A 9 ? VAL A 3 ALA A 9 A 2 ARG A 72 ? CYS A 77 ? ARG A 72 CYS A 77 A 3 LEU A 98 ? GLU A 108 ? LEU A 98 GLU A 108 A 4 VAL A 22 ? THR A 30 ? VAL A 22 THR A 30 A 5 VAL A 36 ? SER A 39 ? VAL A 36 SER A 39 B 1 VAL A 3 ? ALA A 9 ? VAL A 3 ALA A 9 B 2 ARG A 72 ? CYS A 77 ? ARG A 72 CYS A 77 B 3 LEU A 98 ? GLU A 108 ? LEU A 98 GLU A 108 B 4 VAL A 22 ? THR A 30 ? VAL A 22 THR A 30 B 5 PHE A 47 ? THR A 50 ? PHE A 47 THR A 50 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 8 ? N LEU A 8 O ARG A 72 ? O ARG A 72 A 2 3 N LEU A 75 ? N LEU A 75 O PHE A 100 ? O PHE A 100 A 3 4 O GLU A 108 ? O GLU A 108 N VAL A 22 ? N VAL A 22 A 4 5 N GLY A 29 ? N GLY A 29 O PHE A 37 ? O PHE A 37 B 1 2 N LEU A 8 ? N LEU A 8 O ARG A 72 ? O ARG A 72 B 2 3 N LEU A 75 ? N LEU A 75 O PHE A 100 ? O PHE A 100 B 3 4 O GLU A 108 ? O GLU A 108 N VAL A 22 ? N VAL A 22 B 4 5 N ALA A 23 ? N ALA A 23 O PHE A 49 ? O PHE A 49 # _atom_sites.entry_id 2LPV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 HIS 26 26 26 HIS HIS A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 TRP 60 60 60 TRP TRP A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 MET 67 67 67 MET MET A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 CYS 77 77 77 CYS CYS A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 TYR 81 81 81 TYR TYR A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 GLU 108 108 108 GLU GLU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-02-06 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id FKBP12-1 0.5 ? mM '[U-15N]' 1 FKBP12-2 0.5 ? mM '[U-100% 13C; U-100% 15N]' 2 FKBP12-3 0.5 ? mM '[U-100% 13C; U-100% 15N]' 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 14 ? ? -139.12 -41.13 2 1 SER A 85 ? ? -49.15 -71.17 3 1 VAL A 91 ? ? -129.16 -59.15 4 2 ALA A 14 ? ? -138.69 -41.24 5 2 SER A 85 ? ? -50.97 -71.71 6 2 VAL A 91 ? ? -129.39 -59.45 7 3 ALA A 14 ? ? -161.02 -40.23 8 3 SER A 85 ? ? -48.43 -71.31 9 3 VAL A 91 ? ? -128.72 -59.50 10 4 ALA A 14 ? ? -161.85 -40.72 11 4 SER A 85 ? ? -50.35 -71.30 12 4 VAL A 91 ? ? -126.62 -55.12 13 5 GLU A 13 ? ? 39.54 41.73 14 5 ALA A 14 ? ? -147.77 -41.83 15 5 SER A 85 ? ? -50.90 -71.49 16 5 VAL A 91 ? ? -126.62 -55.11 17 6 GLU A 13 ? ? 39.63 41.23 18 6 ALA A 14 ? ? -145.72 -41.67 19 6 SER A 85 ? ? -51.25 -71.62 20 6 VAL A 91 ? ? -129.37 -59.20 21 7 ALA A 14 ? ? -135.52 -40.86 22 7 SER A 85 ? ? -49.10 -71.29 23 7 VAL A 91 ? ? -127.69 -57.25 24 8 ALA A 14 ? ? -140.68 -41.45 25 8 THR A 30 ? ? -170.65 141.54 26 8 SER A 85 ? ? -48.58 -71.44 27 8 VAL A 91 ? ? -129.35 -60.17 28 9 ALA A 14 ? ? -136.66 -40.46 29 9 SER A 85 ? ? -49.09 -71.14 30 9 VAL A 91 ? ? -127.80 -59.19 31 10 ALA A 14 ? ? -133.93 -39.84 32 10 THR A 30 ? ? -171.18 140.42 33 10 SER A 85 ? ? -51.33 -71.58 34 10 VAL A 91 ? ? -130.04 -58.67 35 11 ALA A 14 ? ? -137.08 -40.84 36 11 SER A 85 ? ? -49.13 -71.35 37 11 VAL A 91 ? ? -128.15 -59.66 38 12 ALA A 14 ? ? -130.34 -38.89 39 12 SER A 85 ? ? -50.91 -71.46 40 12 VAL A 91 ? ? -126.38 -54.51 41 13 ALA A 14 ? ? -137.69 -41.17 42 13 VAL A 51 ? ? -63.74 98.58 43 13 SER A 85 ? ? -49.04 -71.52 44 13 VAL A 91 ? ? -129.26 -50.88 45 14 ALA A 14 ? ? -163.75 -39.69 46 14 VAL A 51 ? ? -64.85 99.04 47 14 SER A 85 ? ? -51.40 -71.29 48 14 VAL A 91 ? ? -128.84 -56.94 49 15 GLU A 13 ? ? 39.64 41.44 50 15 ALA A 14 ? ? -147.08 -41.70 51 15 SER A 85 ? ? -48.81 -71.42 52 15 VAL A 91 ? ? -128.92 -58.31 53 16 ALA A 14 ? ? -137.90 -41.01 54 16 THR A 30 ? ? -170.73 143.68 55 16 SER A 85 ? ? -49.10 -71.26 56 16 VAL A 91 ? ? -129.14 -59.83 57 17 GLU A 13 ? ? 39.81 41.10 58 17 ALA A 14 ? ? -140.01 -40.41 59 17 SER A 85 ? ? -50.72 -71.26 60 17 VAL A 91 ? ? -127.55 -55.43 61 18 GLU A 13 ? ? 39.67 41.30 62 18 ALA A 14 ? ? -150.31 -41.76 63 18 THR A 30 ? ? -170.26 142.44 64 18 SER A 85 ? ? -48.88 -71.26 65 18 VAL A 91 ? ? -129.10 -59.72 66 19 ALA A 14 ? ? -137.02 -41.07 67 19 SER A 85 ? ? -49.39 -71.67 68 19 VAL A 91 ? ? -129.72 -58.64 69 20 GLU A 13 ? ? 39.53 41.02 70 20 ALA A 14 ? ? -149.11 -41.61 71 20 SER A 85 ? ? -49.26 -71.30 72 20 VAL A 91 ? ? -128.44 -58.93 #