data_2LQA # _entry.id 2LQA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LQA pdb_00002lqa 10.2210/pdb2lqa/pdb RCSB RCSB102698 ? ? BMRB 18300 ? ? WWPDB D_1000102698 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 3Q8J PDB 'Crystal structure of asteropusin A' unspecified 18300 BMRB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LQA _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2012-02-28 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Li, H.' 1 'Bowling, J.J.' 2 'Hamann, M.T.' 3 'Jung, J.H.' 4 # _citation.id primary _citation.title 'Asteropsin A: An unusual cystine-crosslinked peptide from porifera enhances neuronal Ca(2+) influx' _citation.journal_abbrev Biochim.Biophys.Acta _citation.journal_volume 1830 _citation.page_first 2591 _citation.page_last 2599 _citation.year 2012 _citation.journal_id_ASTM BBACAQ _citation.country NE _citation.journal_id_ISSN 0006-3002 _citation.journal_id_CSD 0113 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23201194 _citation.pdbx_database_id_DOI 10.1016/j.bbagen.2012.11.015 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Li, H.' 1 ? primary 'Bowling, J.J.' 2 ? primary 'Fronczek, F.R.' 3 ? primary 'Hong, J.' 4 ? primary 'Jabba, S.V.' 5 ? primary 'Murray, T.F.' 6 ? primary 'Ha, N.C.' 7 ? primary 'Hamann, M.T.' 8 ? primary 'Jung, J.H.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'Asteropsin A' _entity.formula_weight 3904.384 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code '(PCA)GCAFEGESCNVQFYPCCPGLGLTCIPGNPDGTCYYL' _entity_poly.pdbx_seq_one_letter_code_can QGCAFEGESCNVQFYPCCPGLGLTCIPGNPDGTCYYL _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PCA n 1 2 GLY n 1 3 CYS n 1 4 ALA n 1 5 PHE n 1 6 GLU n 1 7 GLY n 1 8 GLU n 1 9 SER n 1 10 CYS n 1 11 ASN n 1 12 VAL n 1 13 GLN n 1 14 PHE n 1 15 TYR n 1 16 PRO n 1 17 CYS n 1 18 CYS n 1 19 PRO n 1 20 GLY n 1 21 LEU n 1 22 GLY n 1 23 LEU n 1 24 THR n 1 25 CYS n 1 26 ILE n 1 27 PRO n 1 28 GLY n 1 29 ASN n 1 30 PRO n 1 31 ASP n 1 32 GLY n 1 33 THR n 1 34 CYS n 1 35 TYR n 1 36 TYR n 1 37 LEU n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific Asteropus _entity_src_nat.pdbx_ncbi_taxonomy_id 350938 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code I1SB10_9METZ _struct_ref.pdbx_db_accession I1SB10 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code EGCAFEGESCNVQFYPCCPGLGLTCIPGNPDGTCYYL _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LQA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 37 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession I1SB10 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 37 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 37 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 PCA 'L-peptide linking' n 'PYROGLUTAMIC ACID' ? 'C5 H7 N O3' 129.114 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H NOESY' 1 2 1 '2D 1H-1H TOCSY' 1 3 1 '2D DQF-COSY' 1 4 1 '2D 1H-13C HSQC aliphatic' 1 5 1 '2D 1H-13C HSQC aromatic' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '10 mM methanol-1, CD3OH' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system CD3OH # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 500 Varian INOVA 2 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2LQA _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LQA _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LQA _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS 1 1.3 ? refinement CNS 2 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LQA _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LQA _struct.title 'Solution NMR structure of Asteropsin A from marine sponge Asteropus sp.' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LQA _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'KNOTTIN, SPONGE, TOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 18 SG ? ? A CYS 3 A CYS 18 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf2 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 25 SG ? ? A CYS 10 A CYS 25 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf3 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 17 A CYS 34 1_555 ? ? ? ? ? ? ? 2.032 ? ? covale1 covale both ? A PCA 1 C ? ? ? 1_555 A GLY 2 N ? ? A PCA 1 A GLY 2 1_555 ? ? ? ? ? ? ? 1.336 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ILE 26 A . ? ILE 26 A PRO 27 A ? PRO 27 A 1 0.13 2 ASN 29 A . ? ASN 29 A PRO 30 A ? PRO 30 A 1 -0.37 3 ILE 26 A . ? ILE 26 A PRO 27 A ? PRO 27 A 2 0.08 4 ASN 29 A . ? ASN 29 A PRO 30 A ? PRO 30 A 2 -0.37 5 ILE 26 A . ? ILE 26 A PRO 27 A ? PRO 27 A 3 0.23 6 ASN 29 A . ? ASN 29 A PRO 30 A ? PRO 30 A 3 -0.25 7 ILE 26 A . ? ILE 26 A PRO 27 A ? PRO 27 A 4 0.11 8 ASN 29 A . ? ASN 29 A PRO 30 A ? PRO 30 A 4 -0.35 9 ILE 26 A . ? ILE 26 A PRO 27 A ? PRO 27 A 5 0.06 10 ASN 29 A . ? ASN 29 A PRO 30 A ? PRO 30 A 5 -0.31 11 ILE 26 A . ? ILE 26 A PRO 27 A ? PRO 27 A 6 0.07 12 ASN 29 A . ? ASN 29 A PRO 30 A ? PRO 30 A 6 -0.32 13 ILE 26 A . ? ILE 26 A PRO 27 A ? PRO 27 A 7 -0.21 14 ASN 29 A . ? ASN 29 A PRO 30 A ? PRO 30 A 7 -0.25 15 ILE 26 A . ? ILE 26 A PRO 27 A ? PRO 27 A 8 -0.04 16 ASN 29 A . ? ASN 29 A PRO 30 A ? PRO 30 A 8 -0.31 17 ILE 26 A . ? ILE 26 A PRO 27 A ? PRO 27 A 9 0.06 18 ASN 29 A . ? ASN 29 A PRO 30 A ? PRO 30 A 9 -0.28 19 ILE 26 A . ? ILE 26 A PRO 27 A ? PRO 27 A 10 0.11 20 ASN 29 A . ? ASN 29 A PRO 30 A ? PRO 30 A 10 -0.28 21 ILE 26 A . ? ILE 26 A PRO 27 A ? PRO 27 A 11 0.09 22 ASN 29 A . ? ASN 29 A PRO 30 A ? PRO 30 A 11 -0.35 23 ILE 26 A . ? ILE 26 A PRO 27 A ? PRO 27 A 12 0.04 24 ASN 29 A . ? ASN 29 A PRO 30 A ? PRO 30 A 12 -0.34 25 ILE 26 A . ? ILE 26 A PRO 27 A ? PRO 27 A 13 0.06 26 ASN 29 A . ? ASN 29 A PRO 30 A ? PRO 30 A 13 -0.21 27 ILE 26 A . ? ILE 26 A PRO 27 A ? PRO 27 A 14 -0.22 28 ASN 29 A . ? ASN 29 A PRO 30 A ? PRO 30 A 14 -0.27 29 ILE 26 A . ? ILE 26 A PRO 27 A ? PRO 27 A 15 0.07 30 ASN 29 A . ? ASN 29 A PRO 30 A ? PRO 30 A 15 -0.34 31 ILE 26 A . ? ILE 26 A PRO 27 A ? PRO 27 A 16 0.08 32 ASN 29 A . ? ASN 29 A PRO 30 A ? PRO 30 A 16 -0.43 33 ILE 26 A . ? ILE 26 A PRO 27 A ? PRO 27 A 17 0.08 34 ASN 29 A . ? ASN 29 A PRO 30 A ? PRO 30 A 17 -0.41 35 ILE 26 A . ? ILE 26 A PRO 27 A ? PRO 27 A 18 0.04 36 ASN 29 A . ? ASN 29 A PRO 30 A ? PRO 30 A 18 -0.25 37 ILE 26 A . ? ILE 26 A PRO 27 A ? PRO 27 A 19 0.04 38 ASN 29 A . ? ASN 29 A PRO 30 A ? PRO 30 A 19 -0.33 39 ILE 26 A . ? ILE 26 A PRO 27 A ? PRO 27 A 20 0.03 40 ASN 29 A . ? ASN 29 A PRO 30 A ? PRO 30 A 20 -0.35 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 9 ? ASN A 11 ? SER A 9 ASN A 11 A 2 ASP A 31 ? TYR A 36 ? ASP A 31 TYR A 36 A 3 LEU A 23 ? PRO A 27 ? LEU A 23 PRO A 27 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N CYS A 10 ? N CYS A 10 O GLY A 32 ? O GLY A 32 A 2 3 O TYR A 35 ? O TYR A 35 N THR A 24 ? N THR A 24 # _atom_sites.entry_id 2LQA _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PCA 1 1 1 PCA PCA A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 LEU 37 37 37 LEU LEU A . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id PCA _pdbx_struct_mod_residue.label_seq_id 1 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id PCA _pdbx_struct_mod_residue.auth_seq_id 1 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id GLN _pdbx_struct_mod_residue.details 'PYROGLUTAMIC ACID' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-02-06 2 'Structure model' 2 0 2019-12-25 3 'Structure model' 2 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Derived calculations' 2 2 'Structure model' 'Polymer sequence' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' entity_poly 2 2 'Structure model' pdbx_struct_mod_residue 3 2 'Structure model' struct_conn 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can' 2 2 'Structure model' '_pdbx_struct_mod_residue.parent_comp_id' 3 2 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 3 'Structure model' '_database_2.pdbx_DOI' 5 3 'Structure model' '_database_2.pdbx_database_accession' 6 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_nmr_exptl_sample.component methanol-1 _pdbx_nmr_exptl_sample.concentration 10 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling ? _pdbx_nmr_exptl_sample.solution_id 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 14 ? ? -149.94 -26.61 2 2 PHE A 14 ? ? -154.01 -26.77 3 3 PHE A 14 ? ? -149.93 -26.80 4 4 PHE A 14 ? ? -149.84 -26.74 5 5 PHE A 14 ? ? -148.78 -26.68 6 6 PHE A 14 ? ? -149.48 -26.63 7 7 PHE A 14 ? ? -146.87 -27.22 8 8 PHE A 14 ? ? -146.72 -27.35 9 8 ASN A 29 ? ? -150.92 81.05 10 9 PHE A 14 ? ? -148.99 -26.57 11 10 PHE A 14 ? ? -149.70 -26.55 12 11 PHE A 14 ? ? -147.33 -27.01 13 12 PHE A 14 ? ? -149.28 -26.82 14 13 PHE A 14 ? ? -149.00 -26.83 15 14 PHE A 14 ? ? -153.40 -27.68 16 15 PHE A 14 ? ? -149.43 -26.74 17 16 PHE A 14 ? ? -148.24 -27.55 18 17 PHE A 14 ? ? -149.48 -26.79 19 18 PHE A 14 ? ? -149.02 -26.92 20 19 PHE A 14 ? ? -147.95 -27.44 21 20 PHE A 14 ? ? -146.84 -26.70 #