data_2LV1 # _entry.id 2LV1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LV1 pdb_00002lv1 10.2210/pdb2lv1/pdb RCSB RCSB102868 ? ? BMRB 18550 ? ? WWPDB D_1000102868 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 2lej PDB . unspecified 18550 BMRB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LV1 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-06-26 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Biljan, I.' 1 'Ilc, G.' 2 'Giachin, G.' 3 'Legname, G.' 4 'Plavec, J.' 5 # _citation.id primary _citation.title 'Structural Rearrangements at Physiological pH: Nuclear Magnetic Resonance Insights from the V210I Human Prion Protein Mutant.' _citation.journal_abbrev Biochemistry _citation.journal_volume 51 _citation.page_first 7465 _citation.page_last 7474 _citation.year 2012 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22947063 _citation.pdbx_database_id_DOI 10.1021/bi3009856 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Biljan, I.' 1 ? primary 'Ilc, G.' 2 ? primary 'Giachin, G.' 3 ? primary 'Plavec, J.' 4 ? primary 'Legname, G.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Major prion protein' _entity.formula_weight 16654.555 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation V210I _entity.pdbx_fragment 'UNP residues 90-231' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PrP, ASCR, PrP27-30, PrP33-35C' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GAMDPGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYR PMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVIEQMCITQYERESQAYYQRGSS ; _entity_poly.pdbx_seq_one_letter_code_can ;GAMDPGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYR PMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVIEQMCITQYERESQAYYQRGSS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 ASP n 1 5 PRO n 1 6 GLY n 1 7 GLN n 1 8 GLY n 1 9 GLY n 1 10 GLY n 1 11 THR n 1 12 HIS n 1 13 SER n 1 14 GLN n 1 15 TRP n 1 16 ASN n 1 17 LYS n 1 18 PRO n 1 19 SER n 1 20 LYS n 1 21 PRO n 1 22 LYS n 1 23 THR n 1 24 ASN n 1 25 MET n 1 26 LYS n 1 27 HIS n 1 28 MET n 1 29 ALA n 1 30 GLY n 1 31 ALA n 1 32 ALA n 1 33 ALA n 1 34 ALA n 1 35 GLY n 1 36 ALA n 1 37 VAL n 1 38 VAL n 1 39 GLY n 1 40 GLY n 1 41 LEU n 1 42 GLY n 1 43 GLY n 1 44 TYR n 1 45 MET n 1 46 LEU n 1 47 GLY n 1 48 SER n 1 49 ALA n 1 50 MET n 1 51 SER n 1 52 ARG n 1 53 PRO n 1 54 ILE n 1 55 ILE n 1 56 HIS n 1 57 PHE n 1 58 GLY n 1 59 SER n 1 60 ASP n 1 61 TYR n 1 62 GLU n 1 63 ASP n 1 64 ARG n 1 65 TYR n 1 66 TYR n 1 67 ARG n 1 68 GLU n 1 69 ASN n 1 70 MET n 1 71 HIS n 1 72 ARG n 1 73 TYR n 1 74 PRO n 1 75 ASN n 1 76 GLN n 1 77 VAL n 1 78 TYR n 1 79 TYR n 1 80 ARG n 1 81 PRO n 1 82 MET n 1 83 ASP n 1 84 GLU n 1 85 TYR n 1 86 SER n 1 87 ASN n 1 88 GLN n 1 89 ASN n 1 90 ASN n 1 91 PHE n 1 92 VAL n 1 93 HIS n 1 94 ASP n 1 95 CYS n 1 96 VAL n 1 97 ASN n 1 98 ILE n 1 99 THR n 1 100 ILE n 1 101 LYS n 1 102 GLN n 1 103 HIS n 1 104 THR n 1 105 VAL n 1 106 THR n 1 107 THR n 1 108 THR n 1 109 THR n 1 110 LYS n 1 111 GLY n 1 112 GLU n 1 113 ASN n 1 114 PHE n 1 115 THR n 1 116 GLU n 1 117 THR n 1 118 ASP n 1 119 VAL n 1 120 LYS n 1 121 MET n 1 122 MET n 1 123 GLU n 1 124 ARG n 1 125 VAL n 1 126 ILE n 1 127 GLU n 1 128 GLN n 1 129 MET n 1 130 CYS n 1 131 ILE n 1 132 THR n 1 133 GLN n 1 134 TYR n 1 135 GLU n 1 136 ARG n 1 137 GLU n 1 138 SER n 1 139 GLN n 1 140 ALA n 1 141 TYR n 1 142 TYR n 1 143 GLN n 1 144 ARG n 1 145 GLY n 1 146 SER n 1 147 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PRNP, PRIP, PRP' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pProExHTa _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PRIO_HUMAN _struct_ref.pdbx_db_accession P04156 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEY SNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSS ; _struct_ref.pdbx_align_begin 90 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LV1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 147 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P04156 _struct_ref_seq.db_align_beg 90 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 231 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 90 _struct_ref_seq.pdbx_auth_seq_align_end 231 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LV1 GLY A 1 ? UNP P04156 ? ? 'expression tag' 85 1 1 2LV1 ALA A 2 ? UNP P04156 ? ? 'expression tag' 86 2 1 2LV1 MET A 3 ? UNP P04156 ? ? 'expression tag' 87 3 1 2LV1 ASP A 4 ? UNP P04156 ? ? 'expression tag' 88 4 1 2LV1 PRO A 5 ? UNP P04156 ? ? 'expression tag' 89 5 1 2LV1 ILE A 126 ? UNP P04156 VAL 210 'engineered mutation' 210 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-15N HSQC NH2 only' 1 3 1 '2D 1H-13C HSQC aliphatic' 1 4 1 '2D 1H-13C HSQC aromatic' 1 5 1 '3D 1H-13C NOESY aliphatic' 1 6 1 '3D CBCA(CO)NH' 1 7 1 '3D C(CO)NH' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength '20 mM' _pdbx_nmr_exptl_sample_conditions.pH 7.2 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.6 mM [U-100% 13C; U-100% 15N] prion protein mutation V210I, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model VNMRS _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian VNMRS' # _pdbx_nmr_refine.entry_id 2LV1 _pdbx_nmr_refine.method 'molecular dynamics, simulated annealing' _pdbx_nmr_refine.details 'THE FINAL STEP OF STRUCTURE REFINEMENT WAS PERFORMED IN EXPLICIT WATER-BOX, USED FOR AUTOMATED NMR PROTEIN STRUCTURE CALCULATION' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LV1 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 4.7 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.189 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method 'Talos +' # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LV1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 1 'Elmar Krieger' 'geometry optimization' YASARA ? 2 'Elmar Krieger' refinement YASARA ? 3 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 3.0 4 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LV1 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LV1 _struct.title 'Solution-state NMR structure of prion protein mutant V210I at neutral pH' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LV1 _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text 'MEMBRANE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 59 ? TYR A 65 ? SER A 143 TYR A 149 1 ? 7 HELX_P HELX_P2 2 TYR A 65 ? MET A 70 ? TYR A 149 MET A 154 1 ? 6 HELX_P HELX_P3 3 ASN A 87 ? LYS A 110 ? ASN A 171 LYS A 194 1 ? 24 HELX_P HELX_P4 4 THR A 115 ? GLY A 145 ? THR A 199 GLY A 229 1 ? 31 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 95 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 130 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 179 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 214 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.029 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 MET A 45 ? LEU A 46 ? MET A 129 LEU A 130 A 2 TYR A 78 ? TYR A 79 ? TYR A 162 TYR A 163 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id MET _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 45 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id MET _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 129 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id TYR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 79 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 163 # _atom_sites.entry_id 2LV1 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 85 85 GLY GLY A . n A 1 2 ALA 2 86 86 ALA ALA A . n A 1 3 MET 3 87 87 MET MET A . n A 1 4 ASP 4 88 88 ASP ASP A . n A 1 5 PRO 5 89 89 PRO PRO A . n A 1 6 GLY 6 90 90 GLY GLY A . n A 1 7 GLN 7 91 91 GLN GLN A . n A 1 8 GLY 8 92 92 GLY GLY A . n A 1 9 GLY 9 93 93 GLY GLY A . n A 1 10 GLY 10 94 94 GLY GLY A . n A 1 11 THR 11 95 95 THR THR A . n A 1 12 HIS 12 96 96 HIS HIS A . n A 1 13 SER 13 97 97 SER SER A . n A 1 14 GLN 14 98 98 GLN GLN A . n A 1 15 TRP 15 99 99 TRP TRP A . n A 1 16 ASN 16 100 100 ASN ASN A . n A 1 17 LYS 17 101 101 LYS LYS A . n A 1 18 PRO 18 102 102 PRO PRO A . n A 1 19 SER 19 103 103 SER SER A . n A 1 20 LYS 20 104 104 LYS LYS A . n A 1 21 PRO 21 105 105 PRO PRO A . n A 1 22 LYS 22 106 106 LYS LYS A . n A 1 23 THR 23 107 107 THR THR A . n A 1 24 ASN 24 108 108 ASN ASN A . n A 1 25 MET 25 109 109 MET MET A . n A 1 26 LYS 26 110 110 LYS LYS A . n A 1 27 HIS 27 111 111 HIS HIS A . n A 1 28 MET 28 112 112 MET MET A . n A 1 29 ALA 29 113 113 ALA ALA A . n A 1 30 GLY 30 114 114 GLY GLY A . n A 1 31 ALA 31 115 115 ALA ALA A . n A 1 32 ALA 32 116 116 ALA ALA A . n A 1 33 ALA 33 117 117 ALA ALA A . n A 1 34 ALA 34 118 118 ALA ALA A . n A 1 35 GLY 35 119 119 GLY GLY A . n A 1 36 ALA 36 120 120 ALA ALA A . n A 1 37 VAL 37 121 121 VAL VAL A . n A 1 38 VAL 38 122 122 VAL VAL A . n A 1 39 GLY 39 123 123 GLY GLY A . n A 1 40 GLY 40 124 124 GLY GLY A . n A 1 41 LEU 41 125 125 LEU LEU A . n A 1 42 GLY 42 126 126 GLY GLY A . n A 1 43 GLY 43 127 127 GLY GLY A . n A 1 44 TYR 44 128 128 TYR TYR A . n A 1 45 MET 45 129 129 MET MET A . n A 1 46 LEU 46 130 130 LEU LEU A . n A 1 47 GLY 47 131 131 GLY GLY A . n A 1 48 SER 48 132 132 SER SER A . n A 1 49 ALA 49 133 133 ALA ALA A . n A 1 50 MET 50 134 134 MET MET A . n A 1 51 SER 51 135 135 SER SER A . n A 1 52 ARG 52 136 136 ARG ARG A . n A 1 53 PRO 53 137 137 PRO PRO A . n A 1 54 ILE 54 138 138 ILE ILE A . n A 1 55 ILE 55 139 139 ILE ILE A . n A 1 56 HIS 56 140 140 HIS HIS A . n A 1 57 PHE 57 141 141 PHE PHE A . n A 1 58 GLY 58 142 142 GLY GLY A . n A 1 59 SER 59 143 143 SER SER A . n A 1 60 ASP 60 144 144 ASP ASP A . n A 1 61 TYR 61 145 145 TYR TYR A . n A 1 62 GLU 62 146 146 GLU GLU A . n A 1 63 ASP 63 147 147 ASP ASP A . n A 1 64 ARG 64 148 148 ARG ARG A . n A 1 65 TYR 65 149 149 TYR TYR A . n A 1 66 TYR 66 150 150 TYR TYR A . n A 1 67 ARG 67 151 151 ARG ARG A . n A 1 68 GLU 68 152 152 GLU GLU A . n A 1 69 ASN 69 153 153 ASN ASN A . n A 1 70 MET 70 154 154 MET MET A . n A 1 71 HIS 71 155 155 HIS HIS A . n A 1 72 ARG 72 156 156 ARG ARG A . n A 1 73 TYR 73 157 157 TYR TYR A . n A 1 74 PRO 74 158 158 PRO PRO A . n A 1 75 ASN 75 159 159 ASN ASN A . n A 1 76 GLN 76 160 160 GLN GLN A . n A 1 77 VAL 77 161 161 VAL VAL A . n A 1 78 TYR 78 162 162 TYR TYR A . n A 1 79 TYR 79 163 163 TYR TYR A . n A 1 80 ARG 80 164 164 ARG ARG A . n A 1 81 PRO 81 165 165 PRO PRO A . n A 1 82 MET 82 166 166 MET MET A . n A 1 83 ASP 83 167 167 ASP ASP A . n A 1 84 GLU 84 168 168 GLU GLU A . n A 1 85 TYR 85 169 169 TYR TYR A . n A 1 86 SER 86 170 170 SER SER A . n A 1 87 ASN 87 171 171 ASN ASN A . n A 1 88 GLN 88 172 172 GLN GLN A . n A 1 89 ASN 89 173 173 ASN ASN A . n A 1 90 ASN 90 174 174 ASN ASN A . n A 1 91 PHE 91 175 175 PHE PHE A . n A 1 92 VAL 92 176 176 VAL VAL A . n A 1 93 HIS 93 177 177 HIS HIS A . n A 1 94 ASP 94 178 178 ASP ASP A . n A 1 95 CYS 95 179 179 CYS CYS A . n A 1 96 VAL 96 180 180 VAL VAL A . n A 1 97 ASN 97 181 181 ASN ASN A . n A 1 98 ILE 98 182 182 ILE ILE A . n A 1 99 THR 99 183 183 THR THR A . n A 1 100 ILE 100 184 184 ILE ILE A . n A 1 101 LYS 101 185 185 LYS LYS A . n A 1 102 GLN 102 186 186 GLN GLN A . n A 1 103 HIS 103 187 187 HIS HIS A . n A 1 104 THR 104 188 188 THR THR A . n A 1 105 VAL 105 189 189 VAL VAL A . n A 1 106 THR 106 190 190 THR THR A . n A 1 107 THR 107 191 191 THR THR A . n A 1 108 THR 108 192 192 THR THR A . n A 1 109 THR 109 193 193 THR THR A . n A 1 110 LYS 110 194 194 LYS LYS A . n A 1 111 GLY 111 195 195 GLY GLY A . n A 1 112 GLU 112 196 196 GLU GLU A . n A 1 113 ASN 113 197 197 ASN ASN A . n A 1 114 PHE 114 198 198 PHE PHE A . n A 1 115 THR 115 199 199 THR THR A . n A 1 116 GLU 116 200 200 GLU GLU A . n A 1 117 THR 117 201 201 THR THR A . n A 1 118 ASP 118 202 202 ASP ASP A . n A 1 119 VAL 119 203 203 VAL VAL A . n A 1 120 LYS 120 204 204 LYS LYS A . n A 1 121 MET 121 205 205 MET MET A . n A 1 122 MET 122 206 206 MET MET A . n A 1 123 GLU 123 207 207 GLU GLU A . n A 1 124 ARG 124 208 208 ARG ARG A . n A 1 125 VAL 125 209 209 VAL VAL A . n A 1 126 ILE 126 210 210 ILE ILE A . n A 1 127 GLU 127 211 211 GLU GLU A . n A 1 128 GLN 128 212 212 GLN GLN A . n A 1 129 MET 129 213 213 MET MET A . n A 1 130 CYS 130 214 214 CYS CYS A . n A 1 131 ILE 131 215 215 ILE ILE A . n A 1 132 THR 132 216 216 THR THR A . n A 1 133 GLN 133 217 217 GLN GLN A . n A 1 134 TYR 134 218 218 TYR TYR A . n A 1 135 GLU 135 219 219 GLU GLU A . n A 1 136 ARG 136 220 220 ARG ARG A . n A 1 137 GLU 137 221 221 GLU GLU A . n A 1 138 SER 138 222 222 SER SER A . n A 1 139 GLN 139 223 223 GLN GLN A . n A 1 140 ALA 140 224 224 ALA ALA A . n A 1 141 TYR 141 225 225 TYR TYR A . n A 1 142 TYR 142 226 226 TYR TYR A . n A 1 143 GLN 143 227 227 GLN GLN A . n A 1 144 ARG 144 228 228 ARG ARG A . n A 1 145 GLY 145 229 229 GLY GLY A . n A 1 146 SER 146 230 230 SER SER A . n A 1 147 SER 147 231 231 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-09-19 2 'Structure model' 1 1 2012-10-03 3 'Structure model' 1 2 2013-01-30 4 'Structure model' 1 3 2013-02-20 5 'Structure model' 1 4 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Database references' 5 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' database_2 2 5 'Structure model' pdbx_database_status 3 5 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 5 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_nmr_exptl_sample.component 'prion protein mutation V210I-1' _pdbx_nmr_exptl_sample.concentration 0.6 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-100% 13C; U-100% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LV1 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1929 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 452 _pdbx_nmr_constraints.NOE_long_range_total_count 481 _pdbx_nmr_constraints.NOE_medium_range_total_count 516 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 480 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 79 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 79 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 4 NE A ARG 220 ? ? CZ A ARG 220 ? ? NH1 A ARG 220 ? ? 123.41 120.30 3.11 0.50 N 2 7 NE A ARG 208 ? ? CZ A ARG 208 ? ? NH1 A ARG 208 ? ? 123.39 120.30 3.09 0.50 N 3 9 NE A ARG 220 ? ? CZ A ARG 220 ? ? NH1 A ARG 220 ? ? 123.57 120.30 3.27 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 133 ? ? -173.04 -173.95 2 1 ARG A 136 ? ? -154.71 46.02 3 1 TYR A 149 ? ? -163.47 -23.21 4 1 ASP A 167 ? ? -69.98 89.99 5 1 ARG A 228 ? ? -144.27 10.45 6 2 SER A 97 ? ? -148.03 47.89 7 2 LYS A 110 ? ? -121.51 -61.24 8 2 ALA A 133 ? ? -172.96 -171.18 9 2 ARG A 136 ? ? -152.09 43.18 10 2 TYR A 149 ? ? -163.32 -25.87 11 2 ARG A 228 ? ? -149.78 -41.51 12 3 MET A 87 ? ? -113.10 -144.56 13 3 ALA A 117 ? ? -100.33 -78.71 14 3 ARG A 136 ? ? -159.44 55.56 15 3 TYR A 149 ? ? -159.52 -28.24 16 3 PRO A 165 ? ? -76.16 39.35 17 4 HIS A 96 ? ? -96.76 -84.92 18 4 ASN A 108 ? ? -161.08 67.33 19 4 ALA A 115 ? ? -160.69 102.87 20 4 LEU A 125 ? ? -124.57 -51.76 21 4 ALA A 133 ? ? -171.98 -164.34 22 4 ARG A 136 ? ? -150.85 44.24 23 4 TYR A 149 ? ? -161.54 -13.87 24 4 TYR A 169 ? ? -116.41 71.41 25 4 GLU A 196 ? ? -102.99 -164.36 26 5 MET A 87 ? ? -143.36 45.77 27 5 SER A 103 ? ? -81.44 39.92 28 5 ALA A 133 ? ? -161.90 -160.29 29 5 ARG A 136 ? ? -158.06 47.63 30 5 TYR A 149 ? ? -156.37 -11.92 31 5 PRO A 165 ? ? -69.68 1.83 32 6 ALA A 133 ? ? -168.52 -157.74 33 6 ARG A 136 ? ? -152.85 45.81 34 6 TYR A 149 ? ? -157.37 -21.29 35 7 LEU A 125 ? ? -132.53 -36.02 36 7 ARG A 136 ? ? -156.26 46.73 37 7 TYR A 149 ? ? -156.27 -23.67 38 8 MET A 87 ? ? -152.82 40.96 39 8 ALA A 117 ? ? -144.62 -50.82 40 8 ARG A 136 ? ? -150.25 46.64 41 8 TYR A 149 ? ? -160.85 -21.43 42 8 ASP A 167 ? ? -109.86 42.02 43 9 ALA A 116 ? ? 59.16 14.48 44 9 LEU A 125 ? ? -142.56 -50.66 45 9 ALA A 133 ? ? -164.88 -168.68 46 9 ARG A 136 ? ? -156.95 43.13 47 9 TYR A 149 ? ? -156.56 -13.40 48 9 PRO A 165 ? ? -77.49 33.87 49 9 TYR A 169 ? ? -59.76 91.70 50 9 SER A 170 ? ? -153.44 -63.10 51 9 ARG A 228 ? ? -146.27 -15.19 52 10 ASN A 100 ? ? -145.06 -52.29 53 10 SER A 103 ? ? -95.04 -104.49 54 10 ALA A 133 ? ? -177.09 -170.76 55 10 ARG A 136 ? ? -158.23 47.67 56 10 TYR A 149 ? ? -159.10 -25.47 57 10 TYR A 169 ? ? -89.05 42.73 58 10 ARG A 228 ? ? -144.41 -38.80 59 11 ARG A 136 ? ? -157.68 51.45 60 11 TYR A 149 ? ? -162.67 -25.24 61 11 ARG A 164 ? ? -114.98 74.50 62 11 ASP A 167 ? ? -141.67 29.65 63 11 TYR A 169 ? ? -146.40 15.70 64 11 ARG A 228 ? ? -144.86 -5.00 65 12 MET A 112 ? ? -138.34 -65.20 66 12 LEU A 125 ? ? -135.69 -43.82 67 12 ALA A 133 ? ? -166.11 -167.28 68 12 ARG A 136 ? ? -161.17 48.14 69 12 TYR A 149 ? ? -160.32 -20.58 70 12 ARG A 164 ? ? -105.81 79.67 71 13 ARG A 136 ? ? -157.82 58.35 72 13 TYR A 149 ? ? -164.94 -23.23 73 13 MET A 166 ? ? -119.14 73.94 74 14 LYS A 101 ? ? -154.08 75.92 75 14 HIS A 111 ? ? 70.34 164.61 76 14 MET A 112 ? ? -157.51 -74.05 77 14 ALA A 133 ? ? -168.16 -160.25 78 14 ARG A 136 ? ? -157.68 49.94 79 14 TYR A 149 ? ? -159.51 -25.13 80 15 ALA A 115 ? ? -155.51 -37.16 81 15 ARG A 136 ? ? -161.70 58.71 82 15 TYR A 149 ? ? -161.03 -26.77 83 15 TYR A 169 ? ? 34.87 50.60 84 16 ALA A 86 ? ? -109.65 56.94 85 16 THR A 95 ? ? -73.72 22.13 86 16 ASN A 100 ? ? -78.38 44.10 87 16 ARG A 136 ? ? -153.38 44.76 88 16 TYR A 149 ? ? -161.63 -21.32 89 17 ALA A 133 ? ? -167.69 -165.20 90 17 ARG A 136 ? ? -152.93 47.65 91 17 TYR A 149 ? ? -161.30 -20.37 92 17 SER A 230 ? ? -79.39 28.85 93 18 ARG A 136 ? ? -149.52 41.69 94 18 TYR A 149 ? ? -159.24 -24.13 95 18 ARG A 228 ? ? -151.16 84.60 96 19 THR A 107 ? ? -104.74 -106.76 97 19 ALA A 113 ? ? -126.22 -73.77 98 19 ARG A 136 ? ? -154.38 46.13 99 19 TYR A 149 ? ? -155.03 -17.66 100 19 SER A 230 ? ? -159.79 39.80 101 20 MET A 109 ? ? 53.90 177.49 102 20 LYS A 110 ? ? -143.70 -89.55 103 20 ALA A 133 ? ? -174.18 -169.76 104 20 ARG A 136 ? ? -163.64 48.80 105 20 TYR A 149 ? ? -166.23 -25.38 #