data_2M06 # _entry.id 2M06 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2M06 pdb_00002m06 10.2210/pdb2m06/pdb RCSB RCSB103042 ? ? BMRB 18796 ? ? WWPDB D_1000103042 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 4936 BMRB 'chemical shifts in DHPC detergent micelles' unspecified 1q9f PDB 'NMR structure of OmpX in DHPC micelles' unspecified 1qj8 PDB 'Crystal Structure of OmpX' unspecified 18796 BMRB . unspecified 2M07 PDB . unspecified MPSbyNMR-013 TargetTrack . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M06 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-10-21 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hagn, F.X.' 1 'Etzkorn, M.' 2 'Raschle, T.' 3 'Wagner, G.' 4 'Membrane Protein Structures by Solution NMR (MPSbyNMR)' 5 # _citation.id primary _citation.title 'Optimized phospholipid bilayer nanodiscs facilitate high-resolution structure determination of membrane proteins.' _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_volume 135 _citation.page_first 1919 _citation.page_last 1925 _citation.year 2013 _citation.journal_id_ASTM JACSAT _citation.country US _citation.journal_id_ISSN 0002-7863 _citation.journal_id_CSD 0004 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23294159 _citation.pdbx_database_id_DOI 10.1021/ja310901f # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hagn, F.' 1 ? primary 'Etzkorn, M.' 2 ? primary 'Raschle, T.' 3 ? primary 'Wagner, G.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Outer membrane protein X' _entity.formula_weight 16395.812 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 24-171' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIY GVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF ; _entity_poly.pdbx_seq_one_letter_code_can ;ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIY GVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier MPSbyNMR-013 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 THR n 1 3 SER n 1 4 THR n 1 5 VAL n 1 6 THR n 1 7 GLY n 1 8 GLY n 1 9 TYR n 1 10 ALA n 1 11 GLN n 1 12 SER n 1 13 ASP n 1 14 ALA n 1 15 GLN n 1 16 GLY n 1 17 GLN n 1 18 MET n 1 19 ASN n 1 20 LYS n 1 21 MET n 1 22 GLY n 1 23 GLY n 1 24 PHE n 1 25 ASN n 1 26 LEU n 1 27 LYS n 1 28 TYR n 1 29 ARG n 1 30 TYR n 1 31 GLU n 1 32 GLU n 1 33 ASP n 1 34 ASN n 1 35 SER n 1 36 PRO n 1 37 LEU n 1 38 GLY n 1 39 VAL n 1 40 ILE n 1 41 GLY n 1 42 SER n 1 43 PHE n 1 44 THR n 1 45 TYR n 1 46 THR n 1 47 GLU n 1 48 LYS n 1 49 SER n 1 50 ARG n 1 51 THR n 1 52 ALA n 1 53 SER n 1 54 SER n 1 55 GLY n 1 56 ASP n 1 57 TYR n 1 58 ASN n 1 59 LYS n 1 60 ASN n 1 61 GLN n 1 62 TYR n 1 63 TYR n 1 64 GLY n 1 65 ILE n 1 66 THR n 1 67 ALA n 1 68 GLY n 1 69 PRO n 1 70 ALA n 1 71 TYR n 1 72 ARG n 1 73 ILE n 1 74 ASN n 1 75 ASP n 1 76 TRP n 1 77 ALA n 1 78 SER n 1 79 ILE n 1 80 TYR n 1 81 GLY n 1 82 VAL n 1 83 VAL n 1 84 GLY n 1 85 VAL n 1 86 GLY n 1 87 TYR n 1 88 GLY n 1 89 LYS n 1 90 PHE n 1 91 GLN n 1 92 THR n 1 93 THR n 1 94 GLU n 1 95 TYR n 1 96 PRO n 1 97 THR n 1 98 TYR n 1 99 LYS n 1 100 HIS n 1 101 ASP n 1 102 THR n 1 103 SER n 1 104 ASP n 1 105 TYR n 1 106 GLY n 1 107 PHE n 1 108 SER n 1 109 TYR n 1 110 GLY n 1 111 ALA n 1 112 GLY n 1 113 LEU n 1 114 GLN n 1 115 PHE n 1 116 ASN n 1 117 PRO n 1 118 MET n 1 119 GLU n 1 120 ASN n 1 121 VAL n 1 122 ALA n 1 123 LEU n 1 124 ASP n 1 125 PHE n 1 126 SER n 1 127 TYR n 1 128 GLU n 1 129 GLN n 1 130 SER n 1 131 ARG n 1 132 ILE n 1 133 ARG n 1 134 SER n 1 135 VAL n 1 136 ASP n 1 137 VAL n 1 138 GLY n 1 139 THR n 1 140 TRP n 1 141 ILE n 1 142 ALA n 1 143 GLY n 1 144 VAL n 1 145 GLY n 1 146 TYR n 1 147 ARG n 1 148 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ompX, ybiG, b0814, JW0799' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain K12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET11a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code OMPX_ECOLI _struct_ref.pdbx_db_accession P0A917 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIY GVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF ; _struct_ref.pdbx_align_begin 24 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M06 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 148 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0A917 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 171 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 148 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCO' 1 3 1 '3D HNCA' 1 4 1 '3D HN(CO)CA' 1 5 1 '3D HN(CA)CO' 1 6 1 '3D HNCACB' 1 7 1 '3D 1H-15N NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 318 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents ;20 mM potassium phosphate, 50 mM sodium chloride, 10 mM [U-2H] EDTA, 0.05 % sodium azide, 0.8 mM [U-13C; U-15N; U-2H] protein, 95% H2O/5% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 750 Bruker AVANCE 1 'Bruker Avance' 800 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2M06 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M06 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M06 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 1 'Bruker Biospin' collection TopSpin ? 2 'Bruker Biospin' processing TopSpin ? 3 Goddard 'chemical shift assignment' Sparky ? 4 Goddard 'peak picking' Sparky ? 5 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' ? 6 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 7 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2M06 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M06 _struct.title 'NMR structure of OmpX in phopspholipid nanodiscs' _struct.pdbx_model_details 'fewest violations, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M06 _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text 'beta barrel, MEMBRANE PROTEIN, Structural Genomics, PSI-Biology, Membrane Protein Structures by Solution NMR, MPSbyNMR' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel A 8 9 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 3 ? GLN A 15 ? SER A 3 GLN A 15 A 2 LYS A 20 ? TYR A 30 ? LYS A 20 TYR A 30 A 3 GLY A 38 ? LYS A 48 ? GLY A 38 LYS A 48 A 4 ASN A 60 ? ILE A 73 ? ASN A 60 ILE A 73 A 5 ALA A 77 ? PHE A 90 ? ALA A 77 PHE A 90 A 6 ASP A 104 ? PHE A 115 ? ASP A 104 PHE A 115 A 7 ALA A 122 ? ILE A 132 ? ALA A 122 ILE A 132 A 8 VAL A 135 ? PHE A 148 ? VAL A 135 PHE A 148 A 9 SER A 3 ? GLN A 15 ? SER A 3 GLN A 15 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N THR A 6 ? N THR A 6 O LYS A 27 ? O LYS A 27 A 2 3 N GLY A 22 ? N GLY A 22 O GLU A 47 ? O GLU A 47 A 3 4 N THR A 44 ? N THR A 44 O GLY A 64 ? O GLY A 64 A 4 5 N TYR A 71 ? N TYR A 71 O ILE A 79 ? O ILE A 79 A 5 6 N VAL A 82 ? N VAL A 82 O GLY A 110 ? O GLY A 110 A 6 7 N LEU A 113 ? N LEU A 113 O PHE A 125 ? O PHE A 125 A 7 8 N ILE A 132 ? N ILE A 132 O VAL A 135 ? O VAL A 135 A 8 9 O ASP A 136 ? O ASP A 136 N GLN A 15 ? N GLN A 15 # _atom_sites.entry_id 2M06 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 TRP 76 76 76 TRP TRP A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 TYR 87 87 87 TYR TYR A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 TYR 98 98 98 TYR TYR A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 HIS 100 100 100 HIS HIS A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 TYR 105 105 105 TYR TYR A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 TYR 109 109 109 TYR TYR A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 GLN 114 114 114 GLN GLN A . n A 1 115 PHE 115 115 115 PHE PHE A . n A 1 116 ASN 116 116 116 ASN ASN A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 MET 118 118 118 MET MET A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 ASN 120 120 120 ASN ASN A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 TYR 127 127 127 TYR TYR A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 GLN 129 129 129 GLN GLN A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 THR 139 139 139 THR THR A . n A 1 140 TRP 140 140 140 TRP TRP A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 TYR 146 146 146 TYR TYR A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 PHE 148 148 148 PHE PHE A . n # _pdbx_SG_project.full_name_of_center 'Membrane Protein Structures by Solution NMR' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center MPSbyNMR _pdbx_SG_project.project_name PSI:Biology # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-12-12 2 'Structure model' 1 1 2013-01-23 3 'Structure model' 1 2 2013-02-20 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'potassium phosphate-1' 20 ? mM ? 1 'sodium chloride-2' 50 ? mM ? 1 EDTA-3 10 ? mM '[U-2H]' 1 'sodium azide-4' 0.05 ? % ? 1 protein-5 0.8 ? mM '[U-13C; U-15N; U-2H]' 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2M06 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 69 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 58 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 0 _pdbx_nmr_constraints.NOE_long_range_total_count 41 _pdbx_nmr_constraints.NOE_medium_range_total_count 17 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 0 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 53 ? ? -179.61 -73.91 2 1 ASN A 74 ? ? 47.95 27.36 3 1 ASP A 75 ? ? 40.76 28.81 4 1 TRP A 76 ? ? -98.67 -63.69 5 1 ASN A 116 ? ? 58.79 70.95 6 1 PRO A 117 ? ? -86.54 34.80 7 1 GLU A 119 ? ? 57.05 -171.56 8 1 ARG A 133 ? ? 15.66 95.14 9 1 SER A 134 ? ? 75.19 -10.36 10 2 ASN A 19 ? ? 47.61 -174.95 11 2 ASP A 75 ? ? 43.64 26.15 12 2 HIS A 100 ? ? -167.54 -50.68 13 2 ASP A 101 ? ? -145.39 33.41 14 2 PRO A 117 ? ? -61.01 -70.79 15 2 MET A 118 ? ? -79.33 -72.62 16 2 GLU A 119 ? ? -175.14 -68.78 17 2 ARG A 133 ? ? 15.60 95.11 18 2 SER A 134 ? ? 75.33 -10.87 19 3 ASN A 19 ? ? 69.61 145.36 20 3 SER A 53 ? ? 50.92 97.65 21 3 SER A 54 ? ? -174.47 -53.25 22 3 ASN A 58 ? ? -178.94 115.98 23 3 ASN A 74 ? ? 61.59 108.51 24 3 TRP A 76 ? ? 47.55 23.68 25 3 GLU A 94 ? ? 173.91 149.03 26 3 HIS A 100 ? ? 61.82 120.15 27 3 ASN A 116 ? ? 66.73 72.64 28 3 ARG A 133 ? ? 16.68 95.17 29 3 SER A 134 ? ? 73.57 -8.33 30 4 ASN A 19 ? ? 65.62 125.71 31 4 ILE A 73 ? ? -150.14 51.79 32 4 ASN A 74 ? ? 176.08 173.09 33 4 ALA A 77 ? ? 68.81 103.21 34 4 PRO A 117 ? ? -73.62 -165.86 35 4 ARG A 133 ? ? 14.87 95.11 36 4 SER A 134 ? ? 75.17 -10.86 37 5 ASN A 19 ? ? 70.53 120.38 38 5 SER A 53 ? ? -163.05 -67.24 39 5 ASN A 74 ? ? 59.97 -84.62 40 5 GLU A 94 ? ? 174.01 149.13 41 5 HIS A 100 ? ? 41.38 29.95 42 5 PRO A 117 ? ? -91.43 53.04 43 5 ARG A 133 ? ? 17.14 95.20 44 5 SER A 134 ? ? 76.92 -13.46 45 6 TRP A 76 ? ? -103.27 -62.67 46 6 GLU A 94 ? ? 175.83 149.30 47 6 PRO A 117 ? ? -76.37 -167.10 48 6 ARG A 133 ? ? -47.07 95.25 49 6 SER A 134 ? ? 149.93 -54.24 50 7 ASN A 19 ? ? 64.81 142.10 51 7 ILE A 73 ? ? -103.04 -72.29 52 7 GLU A 94 ? ? 178.60 149.27 53 7 PRO A 117 ? ? -70.71 -168.03 54 7 ARG A 133 ? ? 16.69 95.19 55 7 SER A 134 ? ? 75.40 -12.18 56 8 ASN A 19 ? ? 66.61 142.17 57 8 ASN A 74 ? ? 58.25 169.09 58 8 ALA A 77 ? ? 177.60 112.26 59 8 GLU A 94 ? ? 179.96 149.32 60 8 PRO A 117 ? ? -95.74 -158.74 61 8 ARG A 133 ? ? 14.74 95.03 62 8 SER A 134 ? ? 73.14 -7.60 63 9 SER A 53 ? ? -175.22 -67.88 64 9 TRP A 76 ? ? -160.59 -80.66 65 9 ALA A 77 ? ? 177.76 178.85 66 9 HIS A 100 ? ? 46.35 29.19 67 9 THR A 102 ? ? -143.32 -30.59 68 9 PRO A 117 ? ? -75.15 -164.71 69 9 ARG A 133 ? ? 16.38 95.27 70 9 SER A 134 ? ? 75.43 -11.65 71 10 ASN A 19 ? ? -171.40 137.09 72 10 HIS A 100 ? ? 178.95 139.67 73 10 PRO A 117 ? ? -69.99 -163.43 74 10 ARG A 133 ? ? 13.32 95.25 75 10 SER A 134 ? ? 74.78 -9.66 76 11 ASN A 74 ? ? 58.79 112.45 77 11 HIS A 100 ? ? -177.06 -63.54 78 11 MET A 118 ? ? -95.55 -73.47 79 11 GLU A 119 ? ? -175.31 -65.67 80 11 ARG A 133 ? ? 15.06 95.17 81 11 SER A 134 ? ? 74.45 -9.06 82 12 ASN A 19 ? ? 71.45 141.86 83 12 SER A 53 ? ? -169.55 -58.23 84 12 GLU A 94 ? ? -174.68 149.30 85 12 HIS A 100 ? ? -166.54 -55.05 86 12 ASP A 101 ? ? -151.37 81.98 87 12 ARG A 133 ? ? 15.11 95.21 88 12 SER A 134 ? ? 74.75 -9.92 89 13 TRP A 76 ? ? 61.08 -84.33 90 13 ALA A 77 ? ? -178.63 -98.34 91 13 ASN A 116 ? ? 70.28 66.12 92 13 ARG A 133 ? ? 16.49 95.09 93 13 SER A 134 ? ? 73.35 -8.57 94 14 ASN A 19 ? ? 68.00 116.41 95 14 SER A 53 ? ? -173.67 -67.15 96 14 ALA A 77 ? ? -55.91 -177.58 97 14 GLU A 94 ? ? 178.98 149.33 98 14 ASN A 116 ? ? 72.89 65.68 99 14 ARG A 133 ? ? 17.05 95.16 100 14 SER A 134 ? ? 74.20 -8.67 101 15 ILE A 73 ? ? -177.25 -60.49 102 15 TRP A 76 ? ? 57.67 -85.45 103 15 HIS A 100 ? ? -158.97 -43.78 104 15 PRO A 117 ? ? -77.31 -165.81 105 15 ARG A 133 ? ? -45.09 95.02 106 15 SER A 134 ? ? 148.13 -53.95 107 16 ILE A 73 ? ? 80.13 -29.81 108 16 ALA A 77 ? ? 56.67 -173.49 109 16 GLU A 94 ? ? -179.76 149.31 110 16 PRO A 117 ? ? -78.24 -167.91 111 16 ARG A 133 ? ? -45.15 95.14 112 16 SER A 134 ? ? 150.52 -54.05 113 17 ASN A 19 ? ? -176.85 147.30 114 17 SER A 53 ? ? -169.49 -66.68 115 17 ALA A 77 ? ? 61.64 92.63 116 17 GLU A 94 ? ? 173.62 149.20 117 17 HIS A 100 ? ? 66.15 -82.72 118 17 PRO A 117 ? ? -74.85 -168.06 119 17 ARG A 133 ? ? 15.50 95.11 120 17 SER A 134 ? ? 74.04 -8.81 121 18 ASN A 19 ? ? 66.93 135.42 122 18 GLU A 94 ? ? 176.51 149.25 123 18 THR A 102 ? ? -174.73 -39.94 124 18 ARG A 133 ? ? 15.24 95.10 125 18 SER A 134 ? ? 73.45 -7.53 126 19 ASN A 19 ? ? 46.65 -176.26 127 19 ALA A 77 ? ? 52.99 -172.49 128 19 GLU A 94 ? ? -178.64 149.25 129 19 MET A 118 ? ? -95.23 -73.55 130 19 GLU A 119 ? ? -174.94 -62.91 131 19 ARG A 133 ? ? 14.88 95.11 132 19 SER A 134 ? ? 74.40 -9.14 133 20 ASN A 19 ? ? 68.59 133.32 134 20 SER A 53 ? ? 179.82 -70.00 135 20 GLU A 94 ? ? 174.81 149.34 136 20 HIS A 100 ? ? 60.44 -84.26 137 20 ASN A 116 ? ? 66.31 74.66 138 20 ARG A 133 ? ? -43.80 94.98 139 20 SER A 134 ? ? 149.70 -51.87 #