data_2M0X # _entry.id 2M0X # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2M0X pdb_00002m0x 10.2210/pdb2m0x/pdb RCSB RCSB103069 ? ? BMRB 18831 ? ? WWPDB D_1000103069 ? ? # _pdbx_database_related.db_id 18831 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M0X _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-11-08 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Phillips, A.H.' 1 'Fairbrother, W.J.' 2 'Corn, J.E.' 3 # _citation.id primary _citation.title 'Conformational dynamics control ubiquitin-deubiquitinase interactions and influence in vivo signaling.' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 110 _citation.page_first 11379 _citation.page_last 11384 _citation.year 2013 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23801757 _citation.pdbx_database_id_DOI 10.1073/pnas.1302407110 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Phillips, A.H.' 1 ? primary 'Zhang, Y.' 2 ? primary 'Cunningham, C.N.' 3 ? primary 'Zhou, L.' 4 ? primary 'Forrest, W.F.' 5 ? primary 'Liu, P.S.' 6 ? primary 'Steffek, M.' 7 ? primary 'Lee, J.' 8 ? primary 'Tam, C.' 9 ? primary 'Helgason, E.' 10 ? primary 'Murray, J.M.' 11 ? primary 'Kirkpatrick, D.S.' 12 ? primary 'Fairbrother, W.J.' 13 ? primary 'Corn, J.E.' 14 ? # _cell.entry_id 2M0X _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2M0X _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'engineered ubiquitin variant' _entity.formula_weight 8709.896 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSMQIFVKGLTGKTTTLEVEPSDTIENVKAKIQDKTGLPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHIVWRLRGG _entity_poly.pdbx_seq_one_letter_code_can GSMQIFVKGLTGKTTTLEVEPSDTIENVKAKIQDKTGLPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHIVWRLRGG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 GLN n 1 5 ILE n 1 6 PHE n 1 7 VAL n 1 8 LYS n 1 9 GLY n 1 10 LEU n 1 11 THR n 1 12 GLY n 1 13 LYS n 1 14 THR n 1 15 THR n 1 16 THR n 1 17 LEU n 1 18 GLU n 1 19 VAL n 1 20 GLU n 1 21 PRO n 1 22 SER n 1 23 ASP n 1 24 THR n 1 25 ILE n 1 26 GLU n 1 27 ASN n 1 28 VAL n 1 29 LYS n 1 30 ALA n 1 31 LYS n 1 32 ILE n 1 33 GLN n 1 34 ASP n 1 35 LYS n 1 36 THR n 1 37 GLY n 1 38 LEU n 1 39 PRO n 1 40 PRO n 1 41 ASP n 1 42 GLN n 1 43 GLN n 1 44 ARG n 1 45 LEU n 1 46 ILE n 1 47 PHE n 1 48 ALA n 1 49 GLY n 1 50 LYS n 1 51 GLN n 1 52 LEU n 1 53 GLU n 1 54 ASP n 1 55 GLY n 1 56 ARG n 1 57 THR n 1 58 LEU n 1 59 SER n 1 60 ASP n 1 61 TYR n 1 62 ASN n 1 63 ILE n 1 64 GLN n 1 65 LYS n 1 66 GLU n 1 67 SER n 1 68 THR n 1 69 LEU n 1 70 HIS n 1 71 ILE n 1 72 VAL n 1 73 TRP n 1 74 ARG n 1 75 LEU n 1 76 ARG n 1 77 GLY n 1 78 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 2M0X _struct_ref.pdbx_db_accession 2M0X _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M0X _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 78 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 2M0X _struct_ref_seq.db_align_beg -1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 76 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -1 _struct_ref_seq.pdbx_auth_seq_align_end 76 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D HNCA' 1 2 1 '3D HNCACB' 1 3 1 '3D HN(CO)CA' 1 4 1 '3D 1H-15N NOESY' 1 5 1 '3D C(CO)NH' 1 6 1 '3D H(CCO)NH' 1 7 1 '3D 1H-15N TOCSY' 1 8 2 '3D HCCH-COSY' 1 9 2 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.16 _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 297 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM [U-99% 13C; U-99% 15N] protein, 25 mM sodium phosphate, 125 mM sodium chloride, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1 mM [U-99% 13C; U-99% 15N] protein, 25 mM sodium phosphate, 125 mM sodium chloride, 100% D2O' 2 '100% D2O' # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2M0X _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M0X _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M0X _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' ? 1 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 2 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2M0X _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M0X _struct.title 'Solution structure of U14Ub1, an engineered ubiquitin variant with increased affinity for USP14' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M0X _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' _struct_keywords.text 'DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 24 ? THR A 36 ? THR A 22 THR A 34 1 ? 13 HELX_P HELX_P2 2 PRO A 39 ? GLN A 43 ? PRO A 37 GLN A 41 5 ? 5 HELX_P HELX_P3 3 THR A 57 ? ASN A 62 ? THR A 55 ASN A 60 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 14 ? GLU A 18 ? THR A 12 GLU A 16 A 2 GLN A 4 ? LYS A 8 ? GLN A 2 LYS A 6 A 3 LEU A 69 ? HIS A 70 ? LEU A 67 HIS A 68 B 1 ILE A 46 ? PHE A 47 ? ILE A 44 PHE A 45 B 2 LYS A 50 ? GLN A 51 ? LYS A 48 GLN A 49 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 17 ? O LEU A 15 N ILE A 5 ? N ILE A 3 A 2 3 N PHE A 6 ? N PHE A 4 O LEU A 69 ? O LEU A 67 B 1 2 N PHE A 47 ? N PHE A 45 O LYS A 50 ? O LYS A 48 # _atom_sites.entry_id 2M0X _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 SER 2 0 ? ? ? A . n A 1 3 MET 3 1 1 MET MET A . n A 1 4 GLN 4 2 2 GLN GLN A . n A 1 5 ILE 5 3 3 ILE ILE A . n A 1 6 PHE 6 4 4 PHE PHE A . n A 1 7 VAL 7 5 5 VAL VAL A . n A 1 8 LYS 8 6 6 LYS LYS A . n A 1 9 GLY 9 7 7 GLY GLY A . n A 1 10 LEU 10 8 8 LEU LEU A . n A 1 11 THR 11 9 9 THR THR A . n A 1 12 GLY 12 10 10 GLY GLY A . n A 1 13 LYS 13 11 11 LYS LYS A . n A 1 14 THR 14 12 12 THR THR A . n A 1 15 THR 15 13 13 THR THR A . n A 1 16 THR 16 14 14 THR THR A . n A 1 17 LEU 17 15 15 LEU LEU A . n A 1 18 GLU 18 16 16 GLU GLU A . n A 1 19 VAL 19 17 17 VAL VAL A . n A 1 20 GLU 20 18 18 GLU GLU A . n A 1 21 PRO 21 19 19 PRO PRO A . n A 1 22 SER 22 20 20 SER SER A . n A 1 23 ASP 23 21 21 ASP ASP A . n A 1 24 THR 24 22 22 THR THR A . n A 1 25 ILE 25 23 23 ILE ILE A . n A 1 26 GLU 26 24 24 GLU GLU A . n A 1 27 ASN 27 25 25 ASN ASN A . n A 1 28 VAL 28 26 26 VAL VAL A . n A 1 29 LYS 29 27 27 LYS LYS A . n A 1 30 ALA 30 28 28 ALA ALA A . n A 1 31 LYS 31 29 29 LYS LYS A . n A 1 32 ILE 32 30 30 ILE ILE A . n A 1 33 GLN 33 31 31 GLN GLN A . n A 1 34 ASP 34 32 32 ASP ASP A . n A 1 35 LYS 35 33 33 LYS LYS A . n A 1 36 THR 36 34 34 THR THR A . n A 1 37 GLY 37 35 35 GLY GLY A . n A 1 38 LEU 38 36 36 LEU LEU A . n A 1 39 PRO 39 37 37 PRO PRO A . n A 1 40 PRO 40 38 38 PRO PRO A . n A 1 41 ASP 41 39 39 ASP ASP A . n A 1 42 GLN 42 40 40 GLN GLN A . n A 1 43 GLN 43 41 41 GLN GLN A . n A 1 44 ARG 44 42 42 ARG ARG A . n A 1 45 LEU 45 43 43 LEU LEU A . n A 1 46 ILE 46 44 44 ILE ILE A . n A 1 47 PHE 47 45 45 PHE PHE A . n A 1 48 ALA 48 46 46 ALA ALA A . n A 1 49 GLY 49 47 47 GLY GLY A . n A 1 50 LYS 50 48 48 LYS LYS A . n A 1 51 GLN 51 49 49 GLN GLN A . n A 1 52 LEU 52 50 50 LEU LEU A . n A 1 53 GLU 53 51 51 GLU GLU A . n A 1 54 ASP 54 52 52 ASP ASP A . n A 1 55 GLY 55 53 53 GLY GLY A . n A 1 56 ARG 56 54 54 ARG ARG A . n A 1 57 THR 57 55 55 THR THR A . n A 1 58 LEU 58 56 56 LEU LEU A . n A 1 59 SER 59 57 57 SER SER A . n A 1 60 ASP 60 58 58 ASP ASP A . n A 1 61 TYR 61 59 59 TYR TYR A . n A 1 62 ASN 62 60 60 ASN ASN A . n A 1 63 ILE 63 61 61 ILE ILE A . n A 1 64 GLN 64 62 62 GLN GLN A . n A 1 65 LYS 65 63 63 LYS LYS A . n A 1 66 GLU 66 64 64 GLU GLU A . n A 1 67 SER 67 65 65 SER SER A . n A 1 68 THR 68 66 66 THR THR A . n A 1 69 LEU 69 67 67 LEU LEU A . n A 1 70 HIS 70 68 68 HIS HIS A . n A 1 71 ILE 71 69 69 ILE ILE A . n A 1 72 VAL 72 70 70 VAL VAL A . n A 1 73 TRP 73 71 71 TRP TRP A . n A 1 74 ARG 74 72 72 ARG ARG A . n A 1 75 LEU 75 73 73 LEU LEU A . n A 1 76 ARG 76 74 74 ARG ARG A . n A 1 77 GLY 77 75 75 GLY GLY A . n A 1 78 GLY 78 76 76 GLY GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-06-26 2 'Structure model' 1 1 2013-07-10 3 'Structure model' 1 2 2013-07-24 4 'Structure model' 1 3 2016-04-27 5 'Structure model' 1 4 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Structure summary' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' database_2 2 5 'Structure model' pdbx_database_status 3 5 'Structure model' pdbx_nmr_software 4 5 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 5 'Structure model' '_pdbx_nmr_software.name' 5 5 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity-1 1 ? mM '[U-99% 13C; U-99% 15N]' 1 'sodium phosphate-2' 25 ? mM ? 1 'sodium chloride-3' 125 ? mM ? 1 entity-4 1 ? mM '[U-99% 13C; U-99% 15N]' 2 'sodium phosphate-5' 25 ? mM ? 2 'sodium chloride-6' 125 ? mM ? 2 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 5 H A GLU 51 ? ? HH A TYR 59 ? ? 1.27 2 8 H A GLU 51 ? ? HH A TYR 59 ? ? 1.31 3 10 HD21 A LEU 36 ? ? HE1 A TRP 71 ? ? 1.29 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 19 ? ? -39.28 -38.18 2 1 GLN A 62 ? ? -101.24 -162.32 3 2 GLN A 41 ? ? -38.98 148.46 4 2 ALA A 46 ? ? 47.65 26.83 5 2 GLN A 62 ? ? -112.59 -151.85 6 3 GLN A 31 ? ? -49.84 -10.81 7 3 ALA A 46 ? ? 51.47 19.11 8 3 GLN A 62 ? ? -112.21 -154.03 9 4 THR A 9 ? ? -150.16 -9.46 10 4 ASP A 21 ? ? -53.63 107.65 11 4 GLN A 31 ? ? -51.87 -6.33 12 4 GLN A 41 ? ? -31.08 95.68 13 4 ALA A 46 ? ? 50.00 18.30 14 4 GLN A 62 ? ? -110.35 -155.73 15 4 GLU A 64 ? ? 47.59 19.23 16 5 GLN A 40 ? ? -107.09 -67.89 17 5 GLN A 41 ? ? -32.19 146.19 18 5 ALA A 46 ? ? 58.48 9.63 19 5 GLN A 62 ? ? -110.50 -167.22 20 5 ARG A 72 ? ? -172.49 121.45 21 6 PRO A 37 ? ? -41.47 156.91 22 6 ASP A 52 ? ? -47.39 153.71 23 6 GLN A 62 ? ? -112.57 -161.20 24 7 GLN A 31 ? ? -52.92 -7.14 25 7 GLN A 62 ? ? -118.55 -152.15 26 7 GLU A 64 ? ? 47.73 26.86 27 7 ARG A 72 ? ? -160.83 108.43 28 8 PRO A 37 ? ? -42.77 155.99 29 8 ALA A 46 ? ? 50.72 17.19 30 8 GLN A 62 ? ? -122.66 -158.59 31 9 GLN A 31 ? ? -49.45 -11.18 32 9 PRO A 37 ? ? -39.43 156.25 33 9 GLN A 62 ? ? -116.35 -154.17 34 10 THR A 9 ? ? -148.87 -21.73 35 10 GLN A 31 ? ? -55.56 -6.23 36 10 GLN A 62 ? ? -118.42 -153.30 37 10 GLU A 64 ? ? 48.89 19.45 38 10 ARG A 72 ? ? -171.61 114.46 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A SER 0 ? A SER 2 3 2 Y 1 A GLY -1 ? A GLY 1 4 2 Y 1 A SER 0 ? A SER 2 5 3 Y 1 A GLY -1 ? A GLY 1 6 3 Y 1 A SER 0 ? A SER 2 7 4 Y 1 A GLY -1 ? A GLY 1 8 4 Y 1 A SER 0 ? A SER 2 9 5 Y 1 A GLY -1 ? A GLY 1 10 5 Y 1 A SER 0 ? A SER 2 11 6 Y 1 A GLY -1 ? A GLY 1 12 6 Y 1 A SER 0 ? A SER 2 13 7 Y 1 A GLY -1 ? A GLY 1 14 7 Y 1 A SER 0 ? A SER 2 15 8 Y 1 A GLY -1 ? A GLY 1 16 8 Y 1 A SER 0 ? A SER 2 17 9 Y 1 A GLY -1 ? A GLY 1 18 9 Y 1 A SER 0 ? A SER 2 19 10 Y 1 A GLY -1 ? A GLY 1 20 10 Y 1 A SER 0 ? A SER 2 #