data_2M2F # _entry.id 2M2F # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2M2F pdb_00002m2f 10.2210/pdb2m2f/pdb RCSB RCSB103123 ? ? BMRB 18912 ? ? WWPDB D_1000103123 ? ? # _pdbx_database_related.db_id 18912 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M2F _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-12-20 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Duesterhoeft, S.' 1 'Jung, S.' 2 'Hung, C.' 3 'Tholey, A.' 4 'Soennichsen, F.D.' 5 'Groetzinger, J.' 6 'Lorenzen, I.' 7 # _citation.id primary _citation.title ;Membrane-proximal domain of a disintegrin and metalloprotease-17 represents the putative molecular switch of its shedding activity operated by protein-disulfide isomerase. ; _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_volume 135 _citation.page_first 5776 _citation.page_last 5781 _citation.year 2013 _citation.journal_id_ASTM JACSAT _citation.country US _citation.journal_id_ISSN 0002-7863 _citation.journal_id_CSD 0004 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23521534 _citation.pdbx_database_id_DOI 10.1021/ja400340u # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dusterhoft, S.' 1 ? primary 'Jung, S.' 2 ? primary 'Hung, C.W.' 3 ? primary 'Tholey, A.' 4 ? primary 'Sonnichsen, F.D.' 5 ? primary 'Grotzinger, J.' 6 ? primary 'Lorenzen, I.' 7 ? # _cell.entry_id 2M2F _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2M2F _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Disintegrin and metalloproteinase domain-containing protein 17' _entity.formula_weight 9905.123 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.4.24.86 _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 581-642' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ADAM 17, Snake venom-like protease, TNF-alpha convertase, TNF-alpha-converting enzyme' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMDDDDKFCEREQQLESCACNETDNSCKVCCRDLSGRCVPYVDAEQKNLFLRKGKPCTVGF CDMNGKCE ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMDDDDKFCEREQQLESCACNETDNSCKVCCRDLSGRCVPYVDAEQKNLFLRKGKPCTVGF CDMNGKCE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 ASP n 1 23 ASP n 1 24 ASP n 1 25 ASP n 1 26 LYS n 1 27 PHE n 1 28 CYS n 1 29 GLU n 1 30 ARG n 1 31 GLU n 1 32 GLN n 1 33 GLN n 1 34 LEU n 1 35 GLU n 1 36 SER n 1 37 CYS n 1 38 ALA n 1 39 CYS n 1 40 ASN n 1 41 GLU n 1 42 THR n 1 43 ASP n 1 44 ASN n 1 45 SER n 1 46 CYS n 1 47 LYS n 1 48 VAL n 1 49 CYS n 1 50 CYS n 1 51 ARG n 1 52 ASP n 1 53 LEU n 1 54 SER n 1 55 GLY n 1 56 ARG n 1 57 CYS n 1 58 VAL n 1 59 PRO n 1 60 TYR n 1 61 VAL n 1 62 ASP n 1 63 ALA n 1 64 GLU n 1 65 GLN n 1 66 LYS n 1 67 ASN n 1 68 LEU n 1 69 PHE n 1 70 LEU n 1 71 ARG n 1 72 LYS n 1 73 GLY n 1 74 LYS n 1 75 PRO n 1 76 CYS n 1 77 THR n 1 78 VAL n 1 79 GLY n 1 80 PHE n 1 81 CYS n 1 82 ASP n 1 83 MET n 1 84 ASN n 1 85 GLY n 1 86 LYS n 1 87 CYS n 1 88 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ADAM17, CSVP, TACE' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ADA17_HUMAN _struct_ref.pdbx_db_accession P78536 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code FCEREQQLESCACNETDNSCKVCCRDLSGRCVPYVDAEQKNLFLRKGKPCTVGFCDMNGKCE _struct_ref.pdbx_align_begin 581 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M2F _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 27 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 88 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P78536 _struct_ref_seq.db_align_beg 581 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 642 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 62 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2M2F MET A 1 ? UNP P78536 ? ? 'expression tag' -25 1 1 2M2F GLY A 2 ? UNP P78536 ? ? 'expression tag' -24 2 1 2M2F SER A 3 ? UNP P78536 ? ? 'expression tag' -23 3 1 2M2F SER A 4 ? UNP P78536 ? ? 'expression tag' -22 4 1 2M2F HIS A 5 ? UNP P78536 ? ? 'expression tag' -21 5 1 2M2F HIS A 6 ? UNP P78536 ? ? 'expression tag' -20 6 1 2M2F HIS A 7 ? UNP P78536 ? ? 'expression tag' -19 7 1 2M2F HIS A 8 ? UNP P78536 ? ? 'expression tag' -18 8 1 2M2F HIS A 9 ? UNP P78536 ? ? 'expression tag' -17 9 1 2M2F HIS A 10 ? UNP P78536 ? ? 'expression tag' -16 10 1 2M2F SER A 11 ? UNP P78536 ? ? 'expression tag' -15 11 1 2M2F SER A 12 ? UNP P78536 ? ? 'expression tag' -14 12 1 2M2F GLY A 13 ? UNP P78536 ? ? 'expression tag' -13 13 1 2M2F LEU A 14 ? UNP P78536 ? ? 'expression tag' -12 14 1 2M2F VAL A 15 ? UNP P78536 ? ? 'expression tag' -11 15 1 2M2F PRO A 16 ? UNP P78536 ? ? 'expression tag' -10 16 1 2M2F ARG A 17 ? UNP P78536 ? ? 'expression tag' -9 17 1 2M2F GLY A 18 ? UNP P78536 ? ? 'expression tag' -8 18 1 2M2F SER A 19 ? UNP P78536 ? ? 'expression tag' -7 19 1 2M2F HIS A 20 ? UNP P78536 ? ? 'expression tag' -6 20 1 2M2F MET A 21 ? UNP P78536 ? ? 'expression tag' -5 21 1 2M2F ASP A 22 ? UNP P78536 ? ? 'expression tag' -4 22 1 2M2F ASP A 23 ? UNP P78536 ? ? 'expression tag' -3 23 1 2M2F ASP A 24 ? UNP P78536 ? ? 'expression tag' -2 24 1 2M2F ASP A 25 ? UNP P78536 ? ? 'expression tag' -1 25 1 2M2F LYS A 26 ? UNP P78536 ? ? 'expression tag' 0 26 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCA' 1 3 1 '3D HNCO' 1 4 1 '3D HN(CO)CA' 1 5 1 '3D H(CCO)NH' 1 6 1 '3D HN(CA)CO' 1 7 1 '3D HN(CO)CA' 1 8 1 '3D CBCA(CO)NH' 1 9 1 '3D HNCACB' 1 10 1 '3D 1H-15N NOESY' 1 11 1 '3D 1H-15N TOCSY' 1 12 1 '3D 1H-13C NOESY' 1 13 1 '3D 1H-13C NOESY aliphatic' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.15 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1.0 mM [U-100% 13C; U-100% 15N] protein, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Bruker Avance 600' # _pdbx_nmr_refine.entry_id 2M2F _pdbx_nmr_refine.method 'simulated annealing, torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M2F _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M2F _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'data analysis' NMRPipe ? 2 'Johnson, One Moon Scientific' processing NMRPipe ? 3 'Johnson, One Moon Scientific' 'data analysis' NMRPipe ? 4 ? refinement CYANA ? 5 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'Memnbran proximal domain of ADAM17' _exptl.entry_id 2M2F _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M2F _struct.title 'The membran-proximal domain of ADAM17' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M2F _struct_keywords.pdbx_keywords 'HYDROLASE REGULATOR' _struct_keywords.text 'ADAM17, Membrane-proximal domain, HYDROLASE REGULATOR, Closed conformer' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 28 ? GLN A 33 ? CYS A 2 GLN A 7 1 ? 6 HELX_P HELX_P2 2 THR A 42 ? LYS A 47 ? THR A 16 LYS A 21 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 28 SG ? ? ? 1_555 A CYS 50 SG ? ? A CYS 2 A CYS 24 1_555 ? ? ? ? ? ? ? 2.034 ? ? disulf2 disulf ? ? A CYS 37 SG ? ? ? 1_555 A CYS 57 SG ? ? A CYS 11 A CYS 31 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf3 disulf ? ? A CYS 39 SG ? ? ? 1_555 A CYS 49 SG ? ? A CYS 13 A CYS 23 1_555 ? ? ? ? ? ? ? 2.037 ? ? disulf4 disulf ? ? A CYS 46 SG ? ? ? 1_555 A CYS 81 SG ? ? A CYS 20 A CYS 55 1_555 ? ? ? ? ? ? ? 2.025 ? ? disulf5 disulf ? ? A CYS 76 SG ? ? ? 1_555 A CYS 87 SG ? ? A CYS 50 A CYS 61 1_555 ? ? ? ? ? ? ? 2.018 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 35 ? CYS A 37 ? GLU A 9 CYS A 11 A 2 CYS A 49 ? ARG A 51 ? CYS A 23 ARG A 25 A 3 CYS A 57 ? PRO A 59 ? CYS A 31 PRO A 33 B 1 LYS A 74 ? PRO A 75 ? LYS A 48 PRO A 49 B 2 PHE A 80 ? ASP A 82 ? PHE A 54 ASP A 56 B 3 LYS A 86 ? CYS A 87 ? LYS A 60 CYS A 61 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N CYS A 37 ? N CYS A 11 O CYS A 49 ? O CYS A 23 A 2 3 N CYS A 50 ? N CYS A 24 O VAL A 58 ? O VAL A 32 B 1 2 N LYS A 74 ? N LYS A 48 O CYS A 81 ? O CYS A 55 B 2 3 N ASP A 82 ? N ASP A 56 O LYS A 86 ? O LYS A 60 # _atom_sites.entry_id 2M2F _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -25 ? ? ? A . n A 1 2 GLY 2 -24 ? ? ? A . n A 1 3 SER 3 -23 ? ? ? A . n A 1 4 SER 4 -22 ? ? ? A . n A 1 5 HIS 5 -21 ? ? ? A . n A 1 6 HIS 6 -20 ? ? ? A . n A 1 7 HIS 7 -19 ? ? ? A . n A 1 8 HIS 8 -18 ? ? ? A . n A 1 9 HIS 9 -17 ? ? ? A . n A 1 10 HIS 10 -16 ? ? ? A . n A 1 11 SER 11 -15 ? ? ? A . n A 1 12 SER 12 -14 ? ? ? A . n A 1 13 GLY 13 -13 ? ? ? A . n A 1 14 LEU 14 -12 ? ? ? A . n A 1 15 VAL 15 -11 ? ? ? A . n A 1 16 PRO 16 -10 ? ? ? A . n A 1 17 ARG 17 -9 ? ? ? A . n A 1 18 GLY 18 -8 ? ? ? A . n A 1 19 SER 19 -7 ? ? ? A . n A 1 20 HIS 20 -6 ? ? ? A . n A 1 21 MET 21 -5 ? ? ? A . n A 1 22 ASP 22 -4 ? ? ? A . n A 1 23 ASP 23 -3 ? ? ? A . n A 1 24 ASP 24 -2 ? ? ? A . n A 1 25 ASP 25 -1 ? ? ? A . n A 1 26 LYS 26 0 ? ? ? A . n A 1 27 PHE 27 1 1 PHE PHE A . n A 1 28 CYS 28 2 2 CYS CYS A . n A 1 29 GLU 29 3 3 GLU GLU A . n A 1 30 ARG 30 4 4 ARG ARG A . n A 1 31 GLU 31 5 5 GLU GLU A . n A 1 32 GLN 32 6 6 GLN GLN A . n A 1 33 GLN 33 7 7 GLN GLN A . n A 1 34 LEU 34 8 8 LEU LEU A . n A 1 35 GLU 35 9 9 GLU GLU A . n A 1 36 SER 36 10 10 SER SER A . n A 1 37 CYS 37 11 11 CYS CYS A . n A 1 38 ALA 38 12 12 ALA ALA A . n A 1 39 CYS 39 13 13 CYS CYS A . n A 1 40 ASN 40 14 14 ASN ASN A . n A 1 41 GLU 41 15 15 GLU GLU A . n A 1 42 THR 42 16 16 THR THR A . n A 1 43 ASP 43 17 17 ASP ASP A . n A 1 44 ASN 44 18 18 ASN ASN A . n A 1 45 SER 45 19 19 SER SER A . n A 1 46 CYS 46 20 20 CYS CYS A . n A 1 47 LYS 47 21 21 LYS LYS A . n A 1 48 VAL 48 22 22 VAL VAL A . n A 1 49 CYS 49 23 23 CYS CYS A . n A 1 50 CYS 50 24 24 CYS CYS A . n A 1 51 ARG 51 25 25 ARG ARG A . n A 1 52 ASP 52 26 26 ASP ASP A . n A 1 53 LEU 53 27 27 LEU LEU A . n A 1 54 SER 54 28 28 SER SER A . n A 1 55 GLY 55 29 29 GLY GLY A . n A 1 56 ARG 56 30 30 ARG ARG A . n A 1 57 CYS 57 31 31 CYS CYS A . n A 1 58 VAL 58 32 32 VAL VAL A . n A 1 59 PRO 59 33 33 PRO PRO A . n A 1 60 TYR 60 34 34 TYR TYR A . n A 1 61 VAL 61 35 35 VAL VAL A . n A 1 62 ASP 62 36 36 ASP ASP A . n A 1 63 ALA 63 37 37 ALA ALA A . n A 1 64 GLU 64 38 38 GLU GLU A . n A 1 65 GLN 65 39 39 GLN GLN A . n A 1 66 LYS 66 40 40 LYS LYS A . n A 1 67 ASN 67 41 41 ASN ASN A . n A 1 68 LEU 68 42 42 LEU LEU A . n A 1 69 PHE 69 43 43 PHE PHE A . n A 1 70 LEU 70 44 44 LEU LEU A . n A 1 71 ARG 71 45 45 ARG ARG A . n A 1 72 LYS 72 46 46 LYS LYS A . n A 1 73 GLY 73 47 47 GLY GLY A . n A 1 74 LYS 74 48 48 LYS LYS A . n A 1 75 PRO 75 49 49 PRO PRO A . n A 1 76 CYS 76 50 50 CYS CYS A . n A 1 77 THR 77 51 51 THR THR A . n A 1 78 VAL 78 52 52 VAL VAL A . n A 1 79 GLY 79 53 53 GLY GLY A . n A 1 80 PHE 80 54 54 PHE PHE A . n A 1 81 CYS 81 55 55 CYS CYS A . n A 1 82 ASP 82 56 56 ASP ASP A . n A 1 83 MET 83 57 57 MET MET A . n A 1 84 ASN 84 58 58 ASN ASN A . n A 1 85 GLY 85 59 59 GLY GLY A . n A 1 86 LYS 86 60 60 LYS LYS A . n A 1 87 CYS 87 61 61 CYS CYS A . n A 1 88 GLU 88 62 62 GLU GLU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-04-10 2 'Structure model' 1 1 2013-06-19 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_nmr_exptl_sample.component entity-1 _pdbx_nmr_exptl_sample.concentration 1.0 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-100% 13C; U-100% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD2 A ASP 17 ? ? HZ2 A LYS 21 ? ? 1.55 2 1 OE1 A GLU 38 ? ? HZ3 A LYS 40 ? ? 1.56 3 1 OD2 A ASP 36 ? ? HZ2 A LYS 40 ? ? 1.59 4 1 HZ1 A LYS 46 ? ? OD2 A ASP 56 ? ? 1.59 5 2 OD2 A ASP 17 ? ? HZ3 A LYS 21 ? ? 1.57 6 3 OD1 A ASP 17 ? ? HZ2 A LYS 60 ? ? 1.53 7 3 OE2 A GLU 3 ? ? HH21 A ARG 4 ? ? 1.57 8 3 HZ3 A LYS 46 ? ? OD2 A ASP 56 ? ? 1.57 9 3 OE2 A GLU 38 ? ? HZ2 A LYS 40 ? ? 1.59 10 4 OD2 A ASP 17 ? ? HZ3 A LYS 21 ? ? 1.52 11 4 HZ2 A LYS 46 ? ? OD2 A ASP 56 ? ? 1.55 12 4 O A VAL 22 ? ? H A TYR 34 ? ? 1.57 13 4 OE2 A GLU 38 ? ? HZ1 A LYS 40 ? ? 1.57 14 5 OD1 A ASP 17 ? ? HZ3 A LYS 21 ? ? 1.53 15 5 HZ2 A LYS 46 ? ? OD2 A ASP 56 ? ? 1.54 16 5 OD2 A ASP 17 ? ? HZ1 A LYS 60 ? ? 1.56 17 5 OE2 A GLU 3 ? ? HH21 A ARG 4 ? ? 1.60 18 6 OD2 A ASP 17 ? ? HZ3 A LYS 60 ? ? 1.55 19 6 HZ1 A LYS 46 ? ? OE2 A GLU 62 ? ? 1.56 20 6 OD1 A ASP 17 ? ? HZ1 A LYS 21 ? ? 1.58 21 6 HE A ARG 4 ? ? OE1 A GLU 5 ? ? 1.58 22 7 OD2 A ASP 17 ? ? HZ2 A LYS 21 ? ? 1.54 23 8 OD1 A ASP 17 ? ? HZ3 A LYS 60 ? ? 1.55 24 9 HZ2 A LYS 46 ? ? OE1 A GLU 62 ? ? 1.59 25 10 O A CYS 13 ? ? H A GLU 15 ? ? 1.47 26 10 HZ2 A LYS 60 ? ? OE2 A GLU 62 ? ? 1.54 27 10 H A CYS 2 ? ? OE2 A GLU 3 ? ? 1.60 28 11 OD2 A ASP 17 ? ? HZ1 A LYS 21 ? ? 1.59 29 11 H A PHE 1 ? ? OE2 A GLU 3 ? ? 1.60 30 11 HH21 A ARG 4 ? ? OE1 A GLU 5 ? ? 1.60 31 12 OD2 A ASP 17 ? ? HZ2 A LYS 60 ? ? 1.56 32 12 OD1 A ASP 17 ? ? HZ3 A LYS 21 ? ? 1.56 33 12 H A PHE 1 ? ? OE2 A GLU 5 ? ? 1.59 34 13 OD2 A ASP 17 ? ? HZ3 A LYS 21 ? ? 1.52 35 13 OE1 A GLU 38 ? ? HZ3 A LYS 40 ? ? 1.58 36 13 OD2 A ASP 36 ? ? HZ2 A LYS 40 ? ? 1.60 37 14 OE1 A GLU 38 ? ? HZ2 A LYS 40 ? ? 1.54 38 14 HZ2 A LYS 46 ? ? OD1 A ASP 56 ? ? 1.58 39 14 OD2 A ASP 17 ? ? HZ1 A LYS 60 ? ? 1.59 40 15 HZ2 A LYS 46 ? ? OE2 A GLU 62 ? ? 1.56 41 15 OD1 A ASP 17 ? ? HZ1 A LYS 60 ? ? 1.56 42 15 OE2 A GLU 38 ? ? HZ2 A LYS 40 ? ? 1.58 43 15 H A CYS 24 ? ? O A VAL 32 ? ? 1.60 44 16 OE2 A GLU 38 ? ? HZ2 A LYS 40 ? ? 1.60 45 17 OD1 A ASP 17 ? ? HZ2 A LYS 60 ? ? 1.53 46 17 OD2 A ASP 36 ? ? HZ2 A LYS 40 ? ? 1.58 47 17 HZ1 A LYS 46 ? ? OD1 A ASP 56 ? ? 1.59 48 17 O A VAL 22 ? ? H A TYR 34 ? ? 1.59 49 18 OD2 A ASP 17 ? ? HZ1 A LYS 21 ? ? 1.57 50 18 OD1 A ASP 17 ? ? HZ3 A LYS 60 ? ? 1.58 51 18 H A GLY 47 ? ? O A CYS 55 ? ? 1.60 52 19 OD1 A ASP 17 ? ? HZ3 A LYS 60 ? ? 1.53 53 19 H A PHE 1 ? ? OE1 A GLU 3 ? ? 1.57 54 19 OD2 A ASP 17 ? ? HZ1 A LYS 21 ? ? 1.57 55 20 OD2 A ASP 17 ? ? HZ2 A LYS 21 ? ? 1.56 56 20 OE1 A GLU 38 ? ? HZ1 A LYS 40 ? ? 1.58 57 20 OD2 A ASP 36 ? ? HZ3 A LYS 40 ? ? 1.59 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 7 _pdbx_validate_rmsd_bond.auth_atom_id_1 CA _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 ASP _pdbx_validate_rmsd_bond.auth_seq_id_1 36 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 C _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 ASP _pdbx_validate_rmsd_bond.auth_seq_id_2 36 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.368 _pdbx_validate_rmsd_bond.bond_target_value 1.525 _pdbx_validate_rmsd_bond.bond_deviation -0.157 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.026 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 3 ? ? -58.18 -70.95 2 1 GLN A 6 ? ? -145.79 16.77 3 1 GLN A 39 ? ? 71.53 34.06 4 1 ASP A 56 ? ? -104.34 -169.18 5 1 MET A 57 ? ? -65.90 0.45 6 2 CYS A 50 ? ? -129.55 -154.18 7 3 CYS A 2 ? ? 55.16 -29.97 8 3 CYS A 11 ? ? -170.41 -174.91 9 3 ASP A 36 ? ? -101.73 -164.28 10 3 CYS A 50 ? ? -135.18 -154.26 11 5 GLN A 39 ? ? 75.78 35.74 12 6 CYS A 2 ? ? 65.91 -6.63 13 6 GLU A 3 ? ? -56.04 -71.39 14 6 GLN A 6 ? ? -152.21 17.72 15 6 CYS A 50 ? ? -123.85 -162.59 16 7 GLU A 3 ? ? -49.84 -70.96 17 7 ALA A 37 ? ? -30.09 -31.87 18 8 ASP A 36 ? ? -108.03 -165.26 19 8 CYS A 50 ? ? -127.35 -156.96 20 9 ALA A 37 ? ? -30.87 -33.79 21 9 GLN A 39 ? ? 74.35 32.30 22 9 CYS A 50 ? ? -112.65 -159.10 23 10 CYS A 13 ? ? -77.21 40.72 24 10 ASN A 14 ? ? 7.61 -13.81 25 10 ASP A 36 ? ? -100.10 -166.14 26 10 CYS A 50 ? ? -124.73 -156.54 27 10 ASP A 56 ? ? -125.78 -154.04 28 10 MET A 57 ? ? -27.21 -56.85 29 11 GLN A 39 ? ? 74.06 38.48 30 11 LEU A 42 ? ? -171.54 97.78 31 11 LEU A 44 ? ? -66.45 -179.38 32 11 CYS A 50 ? ? -124.80 -162.89 33 12 ASP A 36 ? ? -106.43 -164.83 34 12 GLN A 39 ? ? 77.68 41.92 35 12 LEU A 44 ? ? -67.69 -174.64 36 12 CYS A 50 ? ? -123.15 -161.02 37 13 CYS A 2 ? ? -133.32 -34.98 38 13 LEU A 44 ? ? -68.79 -175.24 39 13 CYS A 50 ? ? -115.03 -156.93 40 13 ASP A 56 ? ? -129.63 -166.62 41 14 GLU A 3 ? ? -57.18 -70.19 42 14 ASP A 36 ? ? -109.24 -169.09 43 14 CYS A 50 ? ? -124.52 -161.34 44 15 ASP A 36 ? ? -104.30 -167.32 45 15 CYS A 50 ? ? -118.73 -156.26 46 16 GLU A 3 ? ? -53.09 -70.49 47 16 LEU A 44 ? ? -61.19 -175.98 48 17 GLU A 3 ? ? -53.99 -70.62 49 18 GLN A 39 ? ? 77.97 34.39 50 18 LEU A 44 ? ? -68.97 -175.98 51 18 ASP A 56 ? ? -120.53 -163.25 52 19 GLN A 39 ? ? 76.10 35.46 53 19 CYS A 50 ? ? -116.54 -161.43 54 20 CYS A 2 ? ? 60.19 -32.02 55 20 ASP A 26 ? ? -104.33 -166.39 56 20 GLN A 39 ? ? 74.53 38.00 57 20 LEU A 44 ? ? -62.32 -175.63 58 20 CYS A 50 ? ? -124.61 -155.34 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 10 _pdbx_validate_main_chain_plane.auth_comp_id CYS _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 13 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle -10.20 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 11 ARG A 25 ? ? 0.074 'SIDE CHAIN' 2 14 ARG A 4 ? ? 0.085 'SIDE CHAIN' 3 20 ARG A 4 ? ? 0.075 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -25 ? A MET 1 2 1 Y 1 A GLY -24 ? A GLY 2 3 1 Y 1 A SER -23 ? A SER 3 4 1 Y 1 A SER -22 ? A SER 4 5 1 Y 1 A HIS -21 ? A HIS 5 6 1 Y 1 A HIS -20 ? A HIS 6 7 1 Y 1 A HIS -19 ? A HIS 7 8 1 Y 1 A HIS -18 ? A HIS 8 9 1 Y 1 A HIS -17 ? A HIS 9 10 1 Y 1 A HIS -16 ? A HIS 10 11 1 Y 1 A SER -15 ? A SER 11 12 1 Y 1 A SER -14 ? A SER 12 13 1 Y 1 A GLY -13 ? A GLY 13 14 1 Y 1 A LEU -12 ? A LEU 14 15 1 Y 1 A VAL -11 ? A VAL 15 16 1 Y 1 A PRO -10 ? A PRO 16 17 1 Y 1 A ARG -9 ? A ARG 17 18 1 Y 1 A GLY -8 ? A GLY 18 19 1 Y 1 A SER -7 ? A SER 19 20 1 Y 1 A HIS -6 ? A HIS 20 21 1 Y 1 A MET -5 ? A MET 21 22 1 Y 1 A ASP -4 ? A ASP 22 23 1 Y 1 A ASP -3 ? A ASP 23 24 1 Y 1 A ASP -2 ? A ASP 24 25 1 Y 1 A ASP -1 ? A ASP 25 26 1 Y 1 A LYS 0 ? A LYS 26 27 2 Y 1 A MET -25 ? A MET 1 28 2 Y 1 A GLY -24 ? A GLY 2 29 2 Y 1 A SER -23 ? A SER 3 30 2 Y 1 A SER -22 ? A SER 4 31 2 Y 1 A HIS -21 ? A HIS 5 32 2 Y 1 A HIS -20 ? A HIS 6 33 2 Y 1 A HIS -19 ? A HIS 7 34 2 Y 1 A HIS -18 ? A HIS 8 35 2 Y 1 A HIS -17 ? A HIS 9 36 2 Y 1 A HIS -16 ? A HIS 10 37 2 Y 1 A SER -15 ? A SER 11 38 2 Y 1 A SER -14 ? A SER 12 39 2 Y 1 A GLY -13 ? A GLY 13 40 2 Y 1 A LEU -12 ? A LEU 14 41 2 Y 1 A VAL -11 ? A VAL 15 42 2 Y 1 A PRO -10 ? A PRO 16 43 2 Y 1 A ARG -9 ? A ARG 17 44 2 Y 1 A GLY -8 ? A GLY 18 45 2 Y 1 A SER -7 ? A SER 19 46 2 Y 1 A HIS -6 ? A HIS 20 47 2 Y 1 A MET -5 ? A MET 21 48 2 Y 1 A ASP -4 ? A ASP 22 49 2 Y 1 A ASP -3 ? A ASP 23 50 2 Y 1 A ASP -2 ? A ASP 24 51 2 Y 1 A ASP -1 ? A ASP 25 52 2 Y 1 A LYS 0 ? A LYS 26 53 3 Y 1 A MET -25 ? A MET 1 54 3 Y 1 A GLY -24 ? A GLY 2 55 3 Y 1 A SER -23 ? A SER 3 56 3 Y 1 A SER -22 ? A SER 4 57 3 Y 1 A HIS -21 ? A HIS 5 58 3 Y 1 A HIS -20 ? A HIS 6 59 3 Y 1 A HIS -19 ? A HIS 7 60 3 Y 1 A HIS -18 ? A HIS 8 61 3 Y 1 A HIS -17 ? A HIS 9 62 3 Y 1 A HIS -16 ? A HIS 10 63 3 Y 1 A SER -15 ? A SER 11 64 3 Y 1 A SER -14 ? A SER 12 65 3 Y 1 A GLY -13 ? A GLY 13 66 3 Y 1 A LEU -12 ? A LEU 14 67 3 Y 1 A VAL -11 ? A VAL 15 68 3 Y 1 A PRO -10 ? A PRO 16 69 3 Y 1 A ARG -9 ? A ARG 17 70 3 Y 1 A GLY -8 ? A GLY 18 71 3 Y 1 A SER -7 ? A SER 19 72 3 Y 1 A HIS -6 ? A HIS 20 73 3 Y 1 A MET -5 ? A MET 21 74 3 Y 1 A ASP -4 ? A ASP 22 75 3 Y 1 A ASP -3 ? A ASP 23 76 3 Y 1 A ASP -2 ? A ASP 24 77 3 Y 1 A ASP -1 ? A ASP 25 78 3 Y 1 A LYS 0 ? A LYS 26 79 4 Y 1 A MET -25 ? A MET 1 80 4 Y 1 A GLY -24 ? A GLY 2 81 4 Y 1 A SER -23 ? A SER 3 82 4 Y 1 A SER -22 ? A SER 4 83 4 Y 1 A HIS -21 ? A HIS 5 84 4 Y 1 A HIS -20 ? A HIS 6 85 4 Y 1 A HIS -19 ? A HIS 7 86 4 Y 1 A HIS -18 ? A HIS 8 87 4 Y 1 A HIS -17 ? A HIS 9 88 4 Y 1 A HIS -16 ? A HIS 10 89 4 Y 1 A SER -15 ? A SER 11 90 4 Y 1 A SER -14 ? A SER 12 91 4 Y 1 A GLY -13 ? A GLY 13 92 4 Y 1 A LEU -12 ? A LEU 14 93 4 Y 1 A VAL -11 ? A VAL 15 94 4 Y 1 A PRO -10 ? A PRO 16 95 4 Y 1 A ARG -9 ? A ARG 17 96 4 Y 1 A GLY -8 ? A GLY 18 97 4 Y 1 A SER -7 ? A SER 19 98 4 Y 1 A HIS -6 ? A HIS 20 99 4 Y 1 A MET -5 ? A MET 21 100 4 Y 1 A ASP -4 ? A ASP 22 101 4 Y 1 A ASP -3 ? A ASP 23 102 4 Y 1 A ASP -2 ? A ASP 24 103 4 Y 1 A ASP -1 ? A ASP 25 104 4 Y 1 A LYS 0 ? A LYS 26 105 5 Y 1 A MET -25 ? A MET 1 106 5 Y 1 A GLY -24 ? A GLY 2 107 5 Y 1 A SER -23 ? A SER 3 108 5 Y 1 A SER -22 ? A SER 4 109 5 Y 1 A HIS -21 ? A HIS 5 110 5 Y 1 A HIS -20 ? A HIS 6 111 5 Y 1 A HIS -19 ? A HIS 7 112 5 Y 1 A HIS -18 ? A HIS 8 113 5 Y 1 A HIS -17 ? A HIS 9 114 5 Y 1 A HIS -16 ? A HIS 10 115 5 Y 1 A SER -15 ? A SER 11 116 5 Y 1 A SER -14 ? A SER 12 117 5 Y 1 A GLY -13 ? A GLY 13 118 5 Y 1 A LEU -12 ? A LEU 14 119 5 Y 1 A VAL -11 ? A VAL 15 120 5 Y 1 A PRO -10 ? A PRO 16 121 5 Y 1 A ARG -9 ? A ARG 17 122 5 Y 1 A GLY -8 ? A GLY 18 123 5 Y 1 A SER -7 ? A SER 19 124 5 Y 1 A HIS -6 ? A HIS 20 125 5 Y 1 A MET -5 ? A MET 21 126 5 Y 1 A ASP -4 ? A ASP 22 127 5 Y 1 A ASP -3 ? A ASP 23 128 5 Y 1 A ASP -2 ? A ASP 24 129 5 Y 1 A ASP -1 ? A ASP 25 130 5 Y 1 A LYS 0 ? A LYS 26 131 6 Y 1 A MET -25 ? A MET 1 132 6 Y 1 A GLY -24 ? A GLY 2 133 6 Y 1 A SER -23 ? A SER 3 134 6 Y 1 A SER -22 ? A SER 4 135 6 Y 1 A HIS -21 ? A HIS 5 136 6 Y 1 A HIS -20 ? A HIS 6 137 6 Y 1 A HIS -19 ? A HIS 7 138 6 Y 1 A HIS -18 ? A HIS 8 139 6 Y 1 A HIS -17 ? A HIS 9 140 6 Y 1 A HIS -16 ? A HIS 10 141 6 Y 1 A SER -15 ? A SER 11 142 6 Y 1 A SER -14 ? A SER 12 143 6 Y 1 A GLY -13 ? A GLY 13 144 6 Y 1 A LEU -12 ? A LEU 14 145 6 Y 1 A VAL -11 ? A VAL 15 146 6 Y 1 A PRO -10 ? A PRO 16 147 6 Y 1 A ARG -9 ? A ARG 17 148 6 Y 1 A GLY -8 ? A GLY 18 149 6 Y 1 A SER -7 ? A SER 19 150 6 Y 1 A HIS -6 ? A HIS 20 151 6 Y 1 A MET -5 ? A MET 21 152 6 Y 1 A ASP -4 ? A ASP 22 153 6 Y 1 A ASP -3 ? A ASP 23 154 6 Y 1 A ASP -2 ? A ASP 24 155 6 Y 1 A ASP -1 ? A ASP 25 156 6 Y 1 A LYS 0 ? A LYS 26 157 7 Y 1 A MET -25 ? A MET 1 158 7 Y 1 A GLY -24 ? A GLY 2 159 7 Y 1 A SER -23 ? A SER 3 160 7 Y 1 A SER -22 ? A SER 4 161 7 Y 1 A HIS -21 ? A HIS 5 162 7 Y 1 A HIS -20 ? A HIS 6 163 7 Y 1 A HIS -19 ? A HIS 7 164 7 Y 1 A HIS -18 ? A HIS 8 165 7 Y 1 A HIS -17 ? A HIS 9 166 7 Y 1 A HIS -16 ? A HIS 10 167 7 Y 1 A SER -15 ? A SER 11 168 7 Y 1 A SER -14 ? A SER 12 169 7 Y 1 A GLY -13 ? A GLY 13 170 7 Y 1 A LEU -12 ? A LEU 14 171 7 Y 1 A VAL -11 ? A VAL 15 172 7 Y 1 A PRO -10 ? A PRO 16 173 7 Y 1 A ARG -9 ? A ARG 17 174 7 Y 1 A GLY -8 ? A GLY 18 175 7 Y 1 A SER -7 ? A SER 19 176 7 Y 1 A HIS -6 ? A HIS 20 177 7 Y 1 A MET -5 ? A MET 21 178 7 Y 1 A ASP -4 ? A ASP 22 179 7 Y 1 A ASP -3 ? A ASP 23 180 7 Y 1 A ASP -2 ? A ASP 24 181 7 Y 1 A ASP -1 ? A ASP 25 182 7 Y 1 A LYS 0 ? A LYS 26 183 8 Y 1 A MET -25 ? A MET 1 184 8 Y 1 A GLY -24 ? A GLY 2 185 8 Y 1 A SER -23 ? A SER 3 186 8 Y 1 A SER -22 ? A SER 4 187 8 Y 1 A HIS -21 ? A HIS 5 188 8 Y 1 A HIS -20 ? A HIS 6 189 8 Y 1 A HIS -19 ? A HIS 7 190 8 Y 1 A HIS -18 ? A HIS 8 191 8 Y 1 A HIS -17 ? A HIS 9 192 8 Y 1 A HIS -16 ? A HIS 10 193 8 Y 1 A SER -15 ? A SER 11 194 8 Y 1 A SER -14 ? A SER 12 195 8 Y 1 A GLY -13 ? A GLY 13 196 8 Y 1 A LEU -12 ? A LEU 14 197 8 Y 1 A VAL -11 ? A VAL 15 198 8 Y 1 A PRO -10 ? A PRO 16 199 8 Y 1 A ARG -9 ? A ARG 17 200 8 Y 1 A GLY -8 ? A GLY 18 201 8 Y 1 A SER -7 ? A SER 19 202 8 Y 1 A HIS -6 ? A HIS 20 203 8 Y 1 A MET -5 ? A MET 21 204 8 Y 1 A ASP -4 ? A ASP 22 205 8 Y 1 A ASP -3 ? A ASP 23 206 8 Y 1 A ASP -2 ? A ASP 24 207 8 Y 1 A ASP -1 ? A ASP 25 208 8 Y 1 A LYS 0 ? A LYS 26 209 9 Y 1 A MET -25 ? A MET 1 210 9 Y 1 A GLY -24 ? A GLY 2 211 9 Y 1 A SER -23 ? A SER 3 212 9 Y 1 A SER -22 ? A SER 4 213 9 Y 1 A HIS -21 ? A HIS 5 214 9 Y 1 A HIS -20 ? A HIS 6 215 9 Y 1 A HIS -19 ? A HIS 7 216 9 Y 1 A HIS -18 ? A HIS 8 217 9 Y 1 A HIS -17 ? A HIS 9 218 9 Y 1 A HIS -16 ? A HIS 10 219 9 Y 1 A SER -15 ? A SER 11 220 9 Y 1 A SER -14 ? A SER 12 221 9 Y 1 A GLY -13 ? A GLY 13 222 9 Y 1 A LEU -12 ? A LEU 14 223 9 Y 1 A VAL -11 ? A VAL 15 224 9 Y 1 A PRO -10 ? A PRO 16 225 9 Y 1 A ARG -9 ? A ARG 17 226 9 Y 1 A GLY -8 ? A GLY 18 227 9 Y 1 A SER -7 ? A SER 19 228 9 Y 1 A HIS -6 ? A HIS 20 229 9 Y 1 A MET -5 ? A MET 21 230 9 Y 1 A ASP -4 ? A ASP 22 231 9 Y 1 A ASP -3 ? A ASP 23 232 9 Y 1 A ASP -2 ? A ASP 24 233 9 Y 1 A ASP -1 ? A ASP 25 234 9 Y 1 A LYS 0 ? A LYS 26 235 10 Y 1 A MET -25 ? A MET 1 236 10 Y 1 A GLY -24 ? A GLY 2 237 10 Y 1 A SER -23 ? A SER 3 238 10 Y 1 A SER -22 ? A SER 4 239 10 Y 1 A HIS -21 ? A HIS 5 240 10 Y 1 A HIS -20 ? A HIS 6 241 10 Y 1 A HIS -19 ? A HIS 7 242 10 Y 1 A HIS -18 ? A HIS 8 243 10 Y 1 A HIS -17 ? A HIS 9 244 10 Y 1 A HIS -16 ? A HIS 10 245 10 Y 1 A SER -15 ? A SER 11 246 10 Y 1 A SER -14 ? A SER 12 247 10 Y 1 A GLY -13 ? A GLY 13 248 10 Y 1 A LEU -12 ? A LEU 14 249 10 Y 1 A VAL -11 ? A VAL 15 250 10 Y 1 A PRO -10 ? A PRO 16 251 10 Y 1 A ARG -9 ? A ARG 17 252 10 Y 1 A GLY -8 ? A GLY 18 253 10 Y 1 A SER -7 ? A SER 19 254 10 Y 1 A HIS -6 ? A HIS 20 255 10 Y 1 A MET -5 ? A MET 21 256 10 Y 1 A ASP -4 ? A ASP 22 257 10 Y 1 A ASP -3 ? A ASP 23 258 10 Y 1 A ASP -2 ? A ASP 24 259 10 Y 1 A ASP -1 ? A ASP 25 260 10 Y 1 A LYS 0 ? A LYS 26 261 11 Y 1 A MET -25 ? A MET 1 262 11 Y 1 A GLY -24 ? A GLY 2 263 11 Y 1 A SER -23 ? A SER 3 264 11 Y 1 A SER -22 ? A SER 4 265 11 Y 1 A HIS -21 ? A HIS 5 266 11 Y 1 A HIS -20 ? A HIS 6 267 11 Y 1 A HIS -19 ? A HIS 7 268 11 Y 1 A HIS -18 ? A HIS 8 269 11 Y 1 A HIS -17 ? A HIS 9 270 11 Y 1 A HIS -16 ? A HIS 10 271 11 Y 1 A SER -15 ? A SER 11 272 11 Y 1 A SER -14 ? A SER 12 273 11 Y 1 A GLY -13 ? A GLY 13 274 11 Y 1 A LEU -12 ? A LEU 14 275 11 Y 1 A VAL -11 ? A VAL 15 276 11 Y 1 A PRO -10 ? A PRO 16 277 11 Y 1 A ARG -9 ? A ARG 17 278 11 Y 1 A GLY -8 ? A GLY 18 279 11 Y 1 A SER -7 ? A SER 19 280 11 Y 1 A HIS -6 ? A HIS 20 281 11 Y 1 A MET -5 ? A MET 21 282 11 Y 1 A ASP -4 ? A ASP 22 283 11 Y 1 A ASP -3 ? A ASP 23 284 11 Y 1 A ASP -2 ? A ASP 24 285 11 Y 1 A ASP -1 ? A ASP 25 286 11 Y 1 A LYS 0 ? A LYS 26 287 12 Y 1 A MET -25 ? A MET 1 288 12 Y 1 A GLY -24 ? A GLY 2 289 12 Y 1 A SER -23 ? A SER 3 290 12 Y 1 A SER -22 ? A SER 4 291 12 Y 1 A HIS -21 ? A HIS 5 292 12 Y 1 A HIS -20 ? A HIS 6 293 12 Y 1 A HIS -19 ? A HIS 7 294 12 Y 1 A HIS -18 ? A HIS 8 295 12 Y 1 A HIS -17 ? A HIS 9 296 12 Y 1 A HIS -16 ? A HIS 10 297 12 Y 1 A SER -15 ? A SER 11 298 12 Y 1 A SER -14 ? A SER 12 299 12 Y 1 A GLY -13 ? A GLY 13 300 12 Y 1 A LEU -12 ? A LEU 14 301 12 Y 1 A VAL -11 ? A VAL 15 302 12 Y 1 A PRO -10 ? A PRO 16 303 12 Y 1 A ARG -9 ? A ARG 17 304 12 Y 1 A GLY -8 ? A GLY 18 305 12 Y 1 A SER -7 ? A SER 19 306 12 Y 1 A HIS -6 ? A HIS 20 307 12 Y 1 A MET -5 ? A MET 21 308 12 Y 1 A ASP -4 ? A ASP 22 309 12 Y 1 A ASP -3 ? A ASP 23 310 12 Y 1 A ASP -2 ? A ASP 24 311 12 Y 1 A ASP -1 ? A ASP 25 312 12 Y 1 A LYS 0 ? A LYS 26 313 13 Y 1 A MET -25 ? A MET 1 314 13 Y 1 A GLY -24 ? A GLY 2 315 13 Y 1 A SER -23 ? A SER 3 316 13 Y 1 A SER -22 ? A SER 4 317 13 Y 1 A HIS -21 ? A HIS 5 318 13 Y 1 A HIS -20 ? A HIS 6 319 13 Y 1 A HIS -19 ? A HIS 7 320 13 Y 1 A HIS -18 ? A HIS 8 321 13 Y 1 A HIS -17 ? A HIS 9 322 13 Y 1 A HIS -16 ? A HIS 10 323 13 Y 1 A SER -15 ? A SER 11 324 13 Y 1 A SER -14 ? A SER 12 325 13 Y 1 A GLY -13 ? A GLY 13 326 13 Y 1 A LEU -12 ? A LEU 14 327 13 Y 1 A VAL -11 ? A VAL 15 328 13 Y 1 A PRO -10 ? A PRO 16 329 13 Y 1 A ARG -9 ? A ARG 17 330 13 Y 1 A GLY -8 ? A GLY 18 331 13 Y 1 A SER -7 ? A SER 19 332 13 Y 1 A HIS -6 ? A HIS 20 333 13 Y 1 A MET -5 ? A MET 21 334 13 Y 1 A ASP -4 ? A ASP 22 335 13 Y 1 A ASP -3 ? A ASP 23 336 13 Y 1 A ASP -2 ? A ASP 24 337 13 Y 1 A ASP -1 ? A ASP 25 338 13 Y 1 A LYS 0 ? A LYS 26 339 14 Y 1 A MET -25 ? A MET 1 340 14 Y 1 A GLY -24 ? A GLY 2 341 14 Y 1 A SER -23 ? A SER 3 342 14 Y 1 A SER -22 ? A SER 4 343 14 Y 1 A HIS -21 ? A HIS 5 344 14 Y 1 A HIS -20 ? A HIS 6 345 14 Y 1 A HIS -19 ? A HIS 7 346 14 Y 1 A HIS -18 ? A HIS 8 347 14 Y 1 A HIS -17 ? A HIS 9 348 14 Y 1 A HIS -16 ? A HIS 10 349 14 Y 1 A SER -15 ? A SER 11 350 14 Y 1 A SER -14 ? A SER 12 351 14 Y 1 A GLY -13 ? A GLY 13 352 14 Y 1 A LEU -12 ? A LEU 14 353 14 Y 1 A VAL -11 ? A VAL 15 354 14 Y 1 A PRO -10 ? A PRO 16 355 14 Y 1 A ARG -9 ? A ARG 17 356 14 Y 1 A GLY -8 ? A GLY 18 357 14 Y 1 A SER -7 ? A SER 19 358 14 Y 1 A HIS -6 ? A HIS 20 359 14 Y 1 A MET -5 ? A MET 21 360 14 Y 1 A ASP -4 ? A ASP 22 361 14 Y 1 A ASP -3 ? A ASP 23 362 14 Y 1 A ASP -2 ? A ASP 24 363 14 Y 1 A ASP -1 ? A ASP 25 364 14 Y 1 A LYS 0 ? A LYS 26 365 15 Y 1 A MET -25 ? A MET 1 366 15 Y 1 A GLY -24 ? A GLY 2 367 15 Y 1 A SER -23 ? A SER 3 368 15 Y 1 A SER -22 ? A SER 4 369 15 Y 1 A HIS -21 ? A HIS 5 370 15 Y 1 A HIS -20 ? A HIS 6 371 15 Y 1 A HIS -19 ? A HIS 7 372 15 Y 1 A HIS -18 ? A HIS 8 373 15 Y 1 A HIS -17 ? A HIS 9 374 15 Y 1 A HIS -16 ? A HIS 10 375 15 Y 1 A SER -15 ? A SER 11 376 15 Y 1 A SER -14 ? A SER 12 377 15 Y 1 A GLY -13 ? A GLY 13 378 15 Y 1 A LEU -12 ? A LEU 14 379 15 Y 1 A VAL -11 ? A VAL 15 380 15 Y 1 A PRO -10 ? A PRO 16 381 15 Y 1 A ARG -9 ? A ARG 17 382 15 Y 1 A GLY -8 ? A GLY 18 383 15 Y 1 A SER -7 ? A SER 19 384 15 Y 1 A HIS -6 ? A HIS 20 385 15 Y 1 A MET -5 ? A MET 21 386 15 Y 1 A ASP -4 ? A ASP 22 387 15 Y 1 A ASP -3 ? A ASP 23 388 15 Y 1 A ASP -2 ? A ASP 24 389 15 Y 1 A ASP -1 ? A ASP 25 390 15 Y 1 A LYS 0 ? A LYS 26 391 16 Y 1 A MET -25 ? A MET 1 392 16 Y 1 A GLY -24 ? A GLY 2 393 16 Y 1 A SER -23 ? A SER 3 394 16 Y 1 A SER -22 ? A SER 4 395 16 Y 1 A HIS -21 ? A HIS 5 396 16 Y 1 A HIS -20 ? A HIS 6 397 16 Y 1 A HIS -19 ? A HIS 7 398 16 Y 1 A HIS -18 ? A HIS 8 399 16 Y 1 A HIS -17 ? A HIS 9 400 16 Y 1 A HIS -16 ? A HIS 10 401 16 Y 1 A SER -15 ? A SER 11 402 16 Y 1 A SER -14 ? A SER 12 403 16 Y 1 A GLY -13 ? A GLY 13 404 16 Y 1 A LEU -12 ? A LEU 14 405 16 Y 1 A VAL -11 ? A VAL 15 406 16 Y 1 A PRO -10 ? A PRO 16 407 16 Y 1 A ARG -9 ? A ARG 17 408 16 Y 1 A GLY -8 ? A GLY 18 409 16 Y 1 A SER -7 ? A SER 19 410 16 Y 1 A HIS -6 ? A HIS 20 411 16 Y 1 A MET -5 ? A MET 21 412 16 Y 1 A ASP -4 ? A ASP 22 413 16 Y 1 A ASP -3 ? A ASP 23 414 16 Y 1 A ASP -2 ? A ASP 24 415 16 Y 1 A ASP -1 ? A ASP 25 416 16 Y 1 A LYS 0 ? A LYS 26 417 17 Y 1 A MET -25 ? A MET 1 418 17 Y 1 A GLY -24 ? A GLY 2 419 17 Y 1 A SER -23 ? A SER 3 420 17 Y 1 A SER -22 ? A SER 4 421 17 Y 1 A HIS -21 ? A HIS 5 422 17 Y 1 A HIS -20 ? A HIS 6 423 17 Y 1 A HIS -19 ? A HIS 7 424 17 Y 1 A HIS -18 ? A HIS 8 425 17 Y 1 A HIS -17 ? A HIS 9 426 17 Y 1 A HIS -16 ? A HIS 10 427 17 Y 1 A SER -15 ? A SER 11 428 17 Y 1 A SER -14 ? A SER 12 429 17 Y 1 A GLY -13 ? A GLY 13 430 17 Y 1 A LEU -12 ? A LEU 14 431 17 Y 1 A VAL -11 ? A VAL 15 432 17 Y 1 A PRO -10 ? A PRO 16 433 17 Y 1 A ARG -9 ? A ARG 17 434 17 Y 1 A GLY -8 ? A GLY 18 435 17 Y 1 A SER -7 ? A SER 19 436 17 Y 1 A HIS -6 ? A HIS 20 437 17 Y 1 A MET -5 ? A MET 21 438 17 Y 1 A ASP -4 ? A ASP 22 439 17 Y 1 A ASP -3 ? A ASP 23 440 17 Y 1 A ASP -2 ? A ASP 24 441 17 Y 1 A ASP -1 ? A ASP 25 442 17 Y 1 A LYS 0 ? A LYS 26 443 18 Y 1 A MET -25 ? A MET 1 444 18 Y 1 A GLY -24 ? A GLY 2 445 18 Y 1 A SER -23 ? A SER 3 446 18 Y 1 A SER -22 ? A SER 4 447 18 Y 1 A HIS -21 ? A HIS 5 448 18 Y 1 A HIS -20 ? A HIS 6 449 18 Y 1 A HIS -19 ? A HIS 7 450 18 Y 1 A HIS -18 ? A HIS 8 451 18 Y 1 A HIS -17 ? A HIS 9 452 18 Y 1 A HIS -16 ? A HIS 10 453 18 Y 1 A SER -15 ? A SER 11 454 18 Y 1 A SER -14 ? A SER 12 455 18 Y 1 A GLY -13 ? A GLY 13 456 18 Y 1 A LEU -12 ? A LEU 14 457 18 Y 1 A VAL -11 ? A VAL 15 458 18 Y 1 A PRO -10 ? A PRO 16 459 18 Y 1 A ARG -9 ? A ARG 17 460 18 Y 1 A GLY -8 ? A GLY 18 461 18 Y 1 A SER -7 ? A SER 19 462 18 Y 1 A HIS -6 ? A HIS 20 463 18 Y 1 A MET -5 ? A MET 21 464 18 Y 1 A ASP -4 ? A ASP 22 465 18 Y 1 A ASP -3 ? A ASP 23 466 18 Y 1 A ASP -2 ? A ASP 24 467 18 Y 1 A ASP -1 ? A ASP 25 468 18 Y 1 A LYS 0 ? A LYS 26 469 19 Y 1 A MET -25 ? A MET 1 470 19 Y 1 A GLY -24 ? A GLY 2 471 19 Y 1 A SER -23 ? A SER 3 472 19 Y 1 A SER -22 ? A SER 4 473 19 Y 1 A HIS -21 ? A HIS 5 474 19 Y 1 A HIS -20 ? A HIS 6 475 19 Y 1 A HIS -19 ? A HIS 7 476 19 Y 1 A HIS -18 ? A HIS 8 477 19 Y 1 A HIS -17 ? A HIS 9 478 19 Y 1 A HIS -16 ? A HIS 10 479 19 Y 1 A SER -15 ? A SER 11 480 19 Y 1 A SER -14 ? A SER 12 481 19 Y 1 A GLY -13 ? A GLY 13 482 19 Y 1 A LEU -12 ? A LEU 14 483 19 Y 1 A VAL -11 ? A VAL 15 484 19 Y 1 A PRO -10 ? A PRO 16 485 19 Y 1 A ARG -9 ? A ARG 17 486 19 Y 1 A GLY -8 ? A GLY 18 487 19 Y 1 A SER -7 ? A SER 19 488 19 Y 1 A HIS -6 ? A HIS 20 489 19 Y 1 A MET -5 ? A MET 21 490 19 Y 1 A ASP -4 ? A ASP 22 491 19 Y 1 A ASP -3 ? A ASP 23 492 19 Y 1 A ASP -2 ? A ASP 24 493 19 Y 1 A ASP -1 ? A ASP 25 494 19 Y 1 A LYS 0 ? A LYS 26 495 20 Y 1 A MET -25 ? A MET 1 496 20 Y 1 A GLY -24 ? A GLY 2 497 20 Y 1 A SER -23 ? A SER 3 498 20 Y 1 A SER -22 ? A SER 4 499 20 Y 1 A HIS -21 ? A HIS 5 500 20 Y 1 A HIS -20 ? A HIS 6 501 20 Y 1 A HIS -19 ? A HIS 7 502 20 Y 1 A HIS -18 ? A HIS 8 503 20 Y 1 A HIS -17 ? A HIS 9 504 20 Y 1 A HIS -16 ? A HIS 10 505 20 Y 1 A SER -15 ? A SER 11 506 20 Y 1 A SER -14 ? A SER 12 507 20 Y 1 A GLY -13 ? A GLY 13 508 20 Y 1 A LEU -12 ? A LEU 14 509 20 Y 1 A VAL -11 ? A VAL 15 510 20 Y 1 A PRO -10 ? A PRO 16 511 20 Y 1 A ARG -9 ? A ARG 17 512 20 Y 1 A GLY -8 ? A GLY 18 513 20 Y 1 A SER -7 ? A SER 19 514 20 Y 1 A HIS -6 ? A HIS 20 515 20 Y 1 A MET -5 ? A MET 21 516 20 Y 1 A ASP -4 ? A ASP 22 517 20 Y 1 A ASP -3 ? A ASP 23 518 20 Y 1 A ASP -2 ? A ASP 24 519 20 Y 1 A ASP -1 ? A ASP 25 520 20 Y 1 A LYS 0 ? A LYS 26 #