data_2M51 # _entry.id 2M51 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2M51 pdb_00002m51 10.2210/pdb2m51/pdb RCSB RCSB103217 ? ? BMRB 19033 ? ? WWPDB D_1000103217 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 4FSS PDB . unspecified 2J05 PDB . unspecified 2J06 PDB . unspecified 2GQI PDB . unspecified 19033 BMRB . unspecified JCSG-422693 TargetTrack . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M51 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-02-12 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Dutta, S.K.' 1 'Serrano, P.' 2 'Geralt, M.' 3 'Wuthrich, K.' 4 'Joint Center for Structural Genomics (JCSG)' 5 'Partnership for T-Cell Biology (TCELL)' 6 # _citation.id primary _citation.title 'NMR structure of the SH3 domain of human RAS p21 protein activator (GTPase activating protein) 1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dutta, S.K.' 1 ? primary 'Serrano, P.' 2 ? primary 'Geralt, M.' 3 ? primary 'Wuthrich, K.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Ras GTPase-activating protein 1' _entity.formula_weight 7268.227 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 281-341' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'GAP, GTPase-activating protein, RasGAP, Ras p21 protein activator, p120GAP' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GRRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGR _entity_poly.pdbx_seq_one_letter_code_can GRRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier JCSG-422693 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ARG n 1 3 ARG n 1 4 ARG n 1 5 VAL n 1 6 ARG n 1 7 ALA n 1 8 ILE n 1 9 LEU n 1 10 PRO n 1 11 TYR n 1 12 THR n 1 13 LYS n 1 14 VAL n 1 15 PRO n 1 16 ASP n 1 17 THR n 1 18 ASP n 1 19 GLU n 1 20 ILE n 1 21 SER n 1 22 PHE n 1 23 LEU n 1 24 LYS n 1 25 GLY n 1 26 ASP n 1 27 MET n 1 28 PHE n 1 29 ILE n 1 30 VAL n 1 31 HIS n 1 32 ASN n 1 33 GLU n 1 34 LEU n 1 35 GLU n 1 36 ASP n 1 37 GLY n 1 38 TRP n 1 39 MET n 1 40 TRP n 1 41 VAL n 1 42 THR n 1 43 ASN n 1 44 LEU n 1 45 ARG n 1 46 THR n 1 47 ASP n 1 48 GLU n 1 49 GLN n 1 50 GLY n 1 51 LEU n 1 52 ILE n 1 53 VAL n 1 54 GLU n 1 55 ASP n 1 56 LEU n 1 57 VAL n 1 58 GLU n 1 59 GLU n 1 60 VAL n 1 61 GLY n 1 62 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'RASA1, RASA' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name SpeedET _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RASA1_HUMAN _struct_ref.pdbx_db_accession P20936 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code RRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGR _struct_ref.pdbx_align_begin 281 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M51 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 62 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P20936 _struct_ref_seq.db_align_beg 281 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 341 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 62 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2M51 _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P20936 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 4D-HACANH-APSY 1 3 1 5D-CBCACONH-APSY 1 4 1 5D-HACACONH-APSY 1 5 1 '3D 1H-13C NOESY aliphatic' 1 6 1 '3D 1H-13C NOESY aliphatic' 1 7 1 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.798 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1.2 mM [U-98% 13C; U-98% 15N] protein, 20 mM sodium phosphate, 50 mM sodium chloride, 5 mM sodium azide, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker AVANCE 1 'Bruker Avance' 800 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2M51 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 80 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M51 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M51 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'G ntert P.' 'structure solution' CYANA 3.0 1 'Bruker Biospin' collection TopSpin ? 2 'Bruker Biospin' processing TopSpin ? 3 'Keller and Wuthrich' 'chemical shift assignment' CARA ? 4 'Keller and Wuthrich' 'data analysis' CARA ? 5 'Herrmann, Guntert and Wuthrich' 'chemical shift assignment' j-UNIO ? 6 'Herrmann, Guntert and Wuthrich' 'peak picking' j-UNIO ? 7 'Herrmann, Guntert and Wuthrich' 'structure solution' j-UNIO ? 8 'Luginbuhl, Guntert, Billeter and Wuthrich' refinement OPAL ? 9 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2M51 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M51 _struct.title 'NMR structure of the SH3 domain of human RAS p21 protein activator (GTPase activating protein) 1' _struct.pdbx_model_details 'closest to the average, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M51 _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text ;SH3 domain of RAS GAP1, PROTEIN BINDING, Structural Genomics, PSI-Biology, Joint Center for Structural Genomics, JCSG, Partnership for T-Cell Biology, TCELL ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 48 ? VAL A 53 ? GLU A 48 VAL A 53 A 2 TRP A 38 ? ASN A 43 ? TRP A 38 ASN A 43 A 3 MET A 27 ? GLU A 33 ? MET A 27 GLU A 33 A 4 ARG A 4 ? ALA A 7 ? ARG A 4 ALA A 7 A 5 VAL A 57 ? GLU A 58 ? VAL A 57 GLU A 58 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLU A 48 ? O GLU A 48 N ASN A 43 ? N ASN A 43 A 2 3 O TRP A 40 ? O TRP A 40 N HIS A 31 ? N HIS A 31 A 3 4 O PHE A 28 ? O PHE A 28 N VAL A 5 ? N VAL A 5 A 4 5 N ARG A 6 ? N ARG A 6 O GLU A 58 ? O GLU A 58 # _atom_sites.entry_id 2M51 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O Q S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 MET 27 27 27 MET MET A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 TRP 38 38 38 TRP TRP A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 TRP 40 40 40 TRP TRP A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 ARG 62 62 62 ARG ARG A . n # loop_ _pdbx_SG_project.full_name_of_center _pdbx_SG_project.id _pdbx_SG_project.initial_of_center _pdbx_SG_project.project_name 'Joint Center for Structural Genomics' 1 JCSG PSI:Biology 'Partnership for T-Cell Biology' 2 TCELL PSI:Biology # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-03-27 2 'Structure model' 1 1 2023-02-01 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_nmr_software 3 2 'Structure model' pdbx_nmr_spectrometer 4 2 'Structure model' struct_ref_seq_dif 5 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_nmr_software.name' 4 2 'Structure model' '_pdbx_nmr_spectrometer.model' 5 2 'Structure model' '_struct_ref_seq_dif.details' 6 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity-1 1.2 ? mM '[U-98% 13C; U-98% 15N]' 1 'sodium phosphate-2' 20 ? mM ? 1 'sodium chloride-3' 50 ? mM ? 1 'sodium azide-4' 5 ? mM ? 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2M51 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1282 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 300 _pdbx_nmr_constraints.NOE_long_range_total_count 458 _pdbx_nmr_constraints.NOE_medium_range_total_count 117 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 358 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 46 ? ? -155.31 15.07 2 1 GLU A 59 ? ? -82.93 47.58 3 2 ARG A 2 ? ? -106.16 -75.98 4 3 ARG A 2 ? ? -65.10 12.11 5 3 ASP A 36 ? ? -152.74 47.59 6 4 ARG A 2 ? ? 56.11 -18.25 7 4 HIS A 31 ? ? -132.75 -30.16 8 4 ASP A 36 ? ? -168.29 -0.74 9 4 THR A 46 ? ? -164.00 13.93 10 5 ARG A 3 ? ? -109.56 -164.48 11 5 LEU A 34 ? ? -109.82 -169.05 12 5 THR A 46 ? ? -164.42 11.14 13 6 ARG A 3 ? ? -124.23 -164.64 14 6 ASP A 16 ? ? 75.45 33.93 15 6 ASP A 18 ? ? -72.50 20.39 16 6 GLU A 35 ? ? -92.91 48.09 17 6 ASP A 36 ? ? -161.28 34.78 18 6 THR A 46 ? ? -163.77 7.35 19 7 ASP A 16 ? ? 75.48 -11.44 20 7 LEU A 34 ? ? -125.82 -168.53 21 7 THR A 46 ? ? -152.96 18.26 22 7 GLU A 59 ? ? -69.80 78.41 23 8 LEU A 34 ? ? -120.33 -168.82 24 8 ASP A 36 ? ? -154.06 22.43 25 8 LEU A 44 ? ? -67.98 1.31 26 8 THR A 46 ? ? -146.13 -3.43 27 9 LEU A 34 ? ? -115.51 -167.49 28 9 ASP A 36 ? ? -168.16 15.80 29 10 PHE A 22 ? ? -170.18 -171.23 30 10 LEU A 34 ? ? -115.10 -163.01 31 10 ASP A 36 ? ? -153.91 1.48 32 10 LEU A 44 ? ? -68.70 1.18 33 10 THR A 46 ? ? -167.39 13.47 34 11 LEU A 34 ? ? -107.18 -163.45 35 11 THR A 46 ? ? -147.96 -8.86 36 11 GLU A 59 ? ? -79.04 37.17 37 12 ARG A 2 ? ? -142.85 43.03 38 12 ASP A 16 ? ? 73.34 43.83 39 12 LEU A 34 ? ? -103.64 -168.90 40 12 ASP A 36 ? ? -159.64 22.65 41 12 THR A 46 ? ? -159.85 12.82 42 13 ARG A 2 ? ? -73.44 49.89 43 13 ASP A 16 ? ? 75.50 -9.06 44 13 LEU A 34 ? ? -108.39 -164.94 45 13 ASP A 36 ? ? -158.25 6.37 46 13 THR A 46 ? ? -169.46 16.29 47 14 ARG A 2 ? ? -144.85 -63.15 48 14 ASP A 36 ? ? -156.60 19.11 49 14 THR A 46 ? ? -152.53 14.56 50 15 THR A 46 ? ? -147.41 -13.27 51 16 ARG A 3 ? ? -127.36 -169.73 52 16 LEU A 34 ? ? -101.81 -169.42 53 16 ASP A 36 ? ? -151.79 29.40 54 16 THR A 46 ? ? -146.15 20.31 55 17 ASP A 36 ? ? -143.41 23.31 56 17 THR A 46 ? ? -169.75 33.51 57 17 ASP A 47 ? ? 66.54 -4.91 58 18 ARG A 2 ? ? 60.46 64.29 59 18 ASP A 18 ? ? -83.40 35.74 60 18 LEU A 34 ? ? -100.85 -162.79 61 18 ASP A 36 ? ? 174.20 -0.97 62 18 THR A 46 ? ? -165.67 -1.61 63 19 LEU A 34 ? ? -109.46 -165.36 64 19 ASP A 36 ? ? 175.85 18.91 65 20 ASP A 36 ? ? -169.90 31.03 66 20 LEU A 44 ? ? -68.87 1.66 67 20 THR A 46 ? ? -158.95 23.31 68 20 GLU A 48 ? ? -68.61 98.86 69 20 LEU A 56 ? ? -140.79 21.86 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 2 ARG A 3 ? ? 0.153 'SIDE CHAIN' 2 2 ARG A 4 ? ? 0.102 'SIDE CHAIN' 3 2 ARG A 62 ? ? 0.081 'SIDE CHAIN' 4 3 ARG A 3 ? ? 0.097 'SIDE CHAIN' 5 4 ARG A 45 ? ? 0.106 'SIDE CHAIN' 6 5 ARG A 3 ? ? 0.105 'SIDE CHAIN' 7 5 ARG A 6 ? ? 0.092 'SIDE CHAIN' 8 9 ARG A 45 ? ? 0.076 'SIDE CHAIN' 9 11 ARG A 3 ? ? 0.103 'SIDE CHAIN' 10 11 ARG A 45 ? ? 0.118 'SIDE CHAIN' 11 12 ARG A 3 ? ? 0.116 'SIDE CHAIN' 12 13 ARG A 2 ? ? 0.082 'SIDE CHAIN' 13 16 ARG A 4 ? ? 0.083 'SIDE CHAIN' 14 18 TYR A 11 ? ? 0.079 'SIDE CHAIN' 15 19 ARG A 4 ? ? 0.082 'SIDE CHAIN' 16 19 ARG A 6 ? ? 0.089 'SIDE CHAIN' 17 20 ARG A 4 ? ? 0.093 'SIDE CHAIN' 18 20 ARG A 6 ? ? 0.105 'SIDE CHAIN' 19 20 ARG A 45 ? ? 0.139 'SIDE CHAIN' #