data_2M94 # _entry.id 2M94 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2M94 pdb_00002m94 10.2210/pdb2m94/pdb RCSB RCSB103364 ? ? BMRB 19282 ? ? WWPDB D_1000103364 ? ? # _pdbx_database_related.db_id 19282 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M94 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-05-31 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chmelik, J.' 1 'Rozbesky, D.' 2 'Pospisilova, E.' 3 'Novak, P.' 4 # _citation.id primary _citation.title ;NMR structure of the lymphocyte receptor NKR-P1A reveals a different conformation of the conserved loop compared to crystal structure ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rozbesky, D.' 1 ? primary 'Pospisilova, E.' 2 ? primary 'Novak, P.' 3 ? primary 'Chmelik, J.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Killer cell lectin-like receptor subfamily B member 1A' _entity.formula_weight 16008.773 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 95-233' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SAKLECPQDWLSHRDKCFHVSQVSNTWEEGLVDCDGKGATLMLIQDQEELRFLLDSIKEKYNSFWIGLRYTLPDMNWKWI NGSTLNSDVLKITGDTENDSCAAISGDKVTFESCNSDNRWICQKELYHETLSNYVGYGH ; _entity_poly.pdbx_seq_one_letter_code_can ;SAKLECPQDWLSHRDKCFHVSQVSNTWEEGLVDCDGKGATLMLIQDQEELRFLLDSIKEKYNSFWIGLRYTLPDMNWKWI NGSTLNSDVLKITGDTENDSCAAISGDKVTFESCNSDNRWICQKELYHETLSNYVGYGH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ALA n 1 3 LYS n 1 4 LEU n 1 5 GLU n 1 6 CYS n 1 7 PRO n 1 8 GLN n 1 9 ASP n 1 10 TRP n 1 11 LEU n 1 12 SER n 1 13 HIS n 1 14 ARG n 1 15 ASP n 1 16 LYS n 1 17 CYS n 1 18 PHE n 1 19 HIS n 1 20 VAL n 1 21 SER n 1 22 GLN n 1 23 VAL n 1 24 SER n 1 25 ASN n 1 26 THR n 1 27 TRP n 1 28 GLU n 1 29 GLU n 1 30 GLY n 1 31 LEU n 1 32 VAL n 1 33 ASP n 1 34 CYS n 1 35 ASP n 1 36 GLY n 1 37 LYS n 1 38 GLY n 1 39 ALA n 1 40 THR n 1 41 LEU n 1 42 MET n 1 43 LEU n 1 44 ILE n 1 45 GLN n 1 46 ASP n 1 47 GLN n 1 48 GLU n 1 49 GLU n 1 50 LEU n 1 51 ARG n 1 52 PHE n 1 53 LEU n 1 54 LEU n 1 55 ASP n 1 56 SER n 1 57 ILE n 1 58 LYS n 1 59 GLU n 1 60 LYS n 1 61 TYR n 1 62 ASN n 1 63 SER n 1 64 PHE n 1 65 TRP n 1 66 ILE n 1 67 GLY n 1 68 LEU n 1 69 ARG n 1 70 TYR n 1 71 THR n 1 72 LEU n 1 73 PRO n 1 74 ASP n 1 75 MET n 1 76 ASN n 1 77 TRP n 1 78 LYS n 1 79 TRP n 1 80 ILE n 1 81 ASN n 1 82 GLY n 1 83 SER n 1 84 THR n 1 85 LEU n 1 86 ASN n 1 87 SER n 1 88 ASP n 1 89 VAL n 1 90 LEU n 1 91 LYS n 1 92 ILE n 1 93 THR n 1 94 GLY n 1 95 ASP n 1 96 THR n 1 97 GLU n 1 98 ASN n 1 99 ASP n 1 100 SER n 1 101 CYS n 1 102 ALA n 1 103 ALA n 1 104 ILE n 1 105 SER n 1 106 GLY n 1 107 ASP n 1 108 LYS n 1 109 VAL n 1 110 THR n 1 111 PHE n 1 112 GLU n 1 113 SER n 1 114 CYS n 1 115 ASN n 1 116 SER n 1 117 ASP n 1 118 ASN n 1 119 ARG n 1 120 TRP n 1 121 ILE n 1 122 CYS n 1 123 GLN n 1 124 LYS n 1 125 GLU n 1 126 LEU n 1 127 TYR n 1 128 HIS n 1 129 GLU n 1 130 THR n 1 131 LEU n 1 132 SER n 1 133 ASN n 1 134 TYR n 1 135 VAL n 1 136 GLY n 1 137 TYR n 1 138 GLY n 1 139 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Klrb1a _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET-30a(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code G5E882_MOUSE _struct_ref.pdbx_db_accession G5E882 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SAKLECPQDWLSHRDKCFHVSQVSNTWEEGLVDCDGKGATLMLIQDQEELRFLLDSIKEKYNSFWIGLRYTLPDMNWKWI NGSTLNSDVLKITGDTENDSCAAISGDKVTFESCNSDNRWICQKELYHETLSNYVGYGH ; _struct_ref.pdbx_align_begin 95 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M94 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 139 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession G5E882 _struct_ref_seq.db_align_beg 95 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 233 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 139 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC aliphatic' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCACB' 1 5 1 '3D HNCA' 1 6 1 '3D HN(CO)CA' 1 7 1 '3D HNCO' 1 8 1 '3D HN(CA)CO' 1 9 1 '3D H(CCO)NH' 1 10 1 '3D H(CCO)NH' 1 11 1 '3D HCCH-TOCSY aliphatic' 1 12 1 '3D 1H-15N NOESY' 1 13 1 '2D 1H-13C HSQC aromatic' 1 14 1 '3D HCCH-TOCSY aromatic' 1 15 1 '2D (HB)CB(CGCD)HD' 1 16 1 '3D 1H-13C NOESY aliphatic' 1 17 1 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.5 mM [U-100% 13C; U-100% 15N] NKR-P1A, 15 mM PIPES, 50 mM sodium chloride, 1 mM sodium azide, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2M94 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M94 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation 0.5 _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 5 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.5 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M94 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin 2.3.6 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 2 Goddard 'chemical shift assignment' Sparky 3.113 3 Goddard 'data analysis' Sparky 3.113 4 Goddard 'peak picking' Sparky 3.113 5 ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA 2.3.1 6 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS 1.21 7 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement RECOORD ? 8 '(CING) Vuister, Doreleijer, da Silva' validation CING ? 9 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2M94 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M94 _struct.title 'NMR structure of the lymphocyte receptor NKR-P1A' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M94 _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM RECEPTOR' _struct_keywords.text 'NK cells, NK receptor, NKR-P1A, C-type lectin-like domain, IMMUNORECEPTOR, IMMUNE SYSTEM RECEPTOR' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 26 ? GLY A 36 ? THR A 26 GLY A 36 1 ? 11 HELX_P HELX_P2 2 ASP A 46 ? LYS A 58 ? ASP A 46 LYS A 58 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 17 SG ? ? A CYS 6 A CYS 17 1_555 ? ? ? ? ? ? ? 2.017 ? ? disulf2 disulf ? ? A CYS 34 SG ? ? ? 1_555 A CYS 122 SG ? ? A CYS 34 A CYS 122 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf3 disulf ? ? A CYS 101 SG ? ? ? 1_555 A CYS 114 SG ? ? A CYS 101 A CYS 114 1_555 ? ? ? ? ? ? ? 2.020 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LEU 72 A . ? LEU 72 A PRO 73 A ? PRO 73 A 1 -3.89 2 LEU 72 A . ? LEU 72 A PRO 73 A ? PRO 73 A 2 -4.57 3 LEU 72 A . ? LEU 72 A PRO 73 A ? PRO 73 A 3 -2.84 4 LEU 72 A . ? LEU 72 A PRO 73 A ? PRO 73 A 4 -3.74 5 LEU 72 A . ? LEU 72 A PRO 73 A ? PRO 73 A 5 -1.52 6 LEU 72 A . ? LEU 72 A PRO 73 A ? PRO 73 A 6 0.87 7 LEU 72 A . ? LEU 72 A PRO 73 A ? PRO 73 A 7 -1.02 8 LEU 72 A . ? LEU 72 A PRO 73 A ? PRO 73 A 8 -2.03 9 LEU 72 A . ? LEU 72 A PRO 73 A ? PRO 73 A 9 -3.32 10 LEU 72 A . ? LEU 72 A PRO 73 A ? PRO 73 A 10 -2.71 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 11 ? HIS A 13 ? LEU A 11 HIS A 13 A 2 LYS A 16 ? ASN A 25 ? LYS A 16 ASN A 25 A 3 ASN A 118 ? GLU A 125 ? ASN A 118 GLU A 125 A 4 PHE A 64 ? THR A 71 ? PHE A 64 THR A 71 A 5 ASN A 76 ? TRP A 79 ? ASN A 76 TRP A 79 B 1 THR A 40 ? LEU A 41 ? THR A 40 LEU A 41 B 2 ASN A 118 ? GLU A 125 ? ASN A 118 GLU A 125 B 3 PHE A 64 ? THR A 71 ? PHE A 64 THR A 71 B 4 SER A 100 ? SER A 105 ? SER A 100 SER A 105 B 5 LYS A 108 ? SER A 113 ? LYS A 108 SER A 113 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 11 ? N LEU A 11 O PHE A 18 ? O PHE A 18 A 2 3 N CYS A 17 ? N CYS A 17 O LYS A 124 ? O LYS A 124 A 3 4 O ARG A 119 ? O ARG A 119 N TRP A 65 ? N TRP A 65 A 4 5 N THR A 71 ? N THR A 71 O ASN A 76 ? O ASN A 76 B 1 2 N THR A 40 ? N THR A 40 O GLN A 123 ? O GLN A 123 B 2 3 O ARG A 119 ? O ARG A 119 N TRP A 65 ? N TRP A 65 B 3 4 N PHE A 64 ? N PHE A 64 O ILE A 104 ? O ILE A 104 B 4 5 N ALA A 103 ? N ALA A 103 O THR A 110 ? O THR A 110 # _atom_sites.entry_id 2M94 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 TRP 10 10 10 TRP TRP A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 TRP 27 27 27 TRP TRP A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 MET 42 42 42 MET MET A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 TRP 65 65 65 TRP TRP A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 MET 75 75 75 MET MET A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 TRP 77 77 77 TRP TRP A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 TRP 79 79 79 TRP TRP A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 CYS 101 101 101 CYS CYS A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 CYS 114 114 114 CYS CYS A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 TRP 120 120 120 TRP TRP A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 CYS 122 122 122 CYS CYS A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 TYR 127 127 127 TYR TYR A . n A 1 128 HIS 128 128 128 HIS HIS A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 ASN 133 133 133 ASN ASN A . n A 1 134 TYR 134 134 134 TYR TYR A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 TYR 137 137 137 TYR TYR A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 HIS 139 139 139 HIS HIS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-06-11 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.01599454 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.00086912 _pdbx_nmr_ensemble_rms.entry_id 2M94 _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id NKR-P1A-1 0.5 ? mM '[U-100% 13C; U-100% 15N]' 1 PIPES-2 15 ? mM ? 1 'sodium chloride-3' 50 ? mM ? 1 'sodium azide-4' 1 ? mM ? 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2M94 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 60 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 2466 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 1124 _pdbx_nmr_constraints.NOE_long_range_total_count 641 _pdbx_nmr_constraints.NOE_medium_range_total_count 216 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 485 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 55 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 91 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 91 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HZ3 A LYS 16 ? ? OE1 A GLU 49 ? ? 1.55 2 1 OE2 A GLU 125 ? ? HD1 A HIS 128 ? ? 1.60 3 2 HZ1 A LYS 60 ? ? OD1 A ASP 107 ? ? 1.60 4 3 HZ1 A LYS 16 ? ? OE1 A GLU 49 ? ? 1.55 5 3 HG1 A THR 26 ? ? OE1 A GLU 28 ? ? 1.58 6 5 OD1 A ASP 15 ? ? HZ3 A LYS 16 ? ? 1.58 7 5 HZ2 A LYS 16 ? ? OE2 A GLU 49 ? ? 1.58 8 7 OD1 A ASP 15 ? ? HZ3 A LYS 16 ? ? 1.58 9 8 OD2 A ASP 15 ? ? HZ3 A LYS 16 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 14 ? ? 62.08 -89.93 2 1 MET A 42 ? ? -35.52 123.50 3 1 LYS A 58 ? ? 68.55 -58.88 4 1 LYS A 60 ? ? 72.12 -58.34 5 1 ASN A 62 ? ? -79.36 -156.01 6 1 ASP A 74 ? ? 175.09 -31.78 7 1 LEU A 131 ? ? -167.62 114.40 8 1 ASN A 133 ? ? -125.51 -98.65 9 1 TYR A 134 ? ? 179.43 113.89 10 2 ARG A 14 ? ? 57.90 -99.03 11 2 MET A 42 ? ? -26.39 123.82 12 2 LYS A 58 ? ? 68.07 -61.26 13 2 LYS A 60 ? ? 69.13 -4.03 14 2 ASP A 74 ? ? -179.29 -32.33 15 2 CYS A 114 ? ? -49.85 -15.70 16 2 LEU A 131 ? ? -155.54 87.22 17 2 SER A 132 ? ? 164.22 162.13 18 2 ASN A 133 ? ? -135.87 -61.14 19 3 ALA A 2 ? ? -95.53 -79.05 20 3 ARG A 14 ? ? 66.82 -90.49 21 3 ASP A 15 ? ? -153.99 35.71 22 3 MET A 42 ? ? -27.49 122.01 23 3 LYS A 58 ? ? 68.12 -72.59 24 3 LYS A 60 ? ? 72.14 -27.95 25 3 ASN A 62 ? ? -113.01 -161.96 26 3 ASP A 74 ? ? -173.63 -35.78 27 3 LYS A 91 ? ? -68.03 97.62 28 3 THR A 96 ? ? -155.40 7.51 29 3 TYR A 134 ? ? -96.24 -75.02 30 4 ALA A 2 ? ? 55.07 -161.99 31 4 LYS A 3 ? ? 71.45 125.69 32 4 ARG A 14 ? ? 59.05 -92.38 33 4 MET A 42 ? ? -25.33 122.74 34 4 LYS A 58 ? ? 67.84 -59.37 35 4 LYS A 60 ? ? 77.32 -11.64 36 4 ASP A 74 ? ? 165.49 -33.38 37 4 GLU A 97 ? ? 69.16 -50.30 38 4 ASP A 99 ? ? -79.56 28.25 39 4 LEU A 131 ? ? -118.80 -164.90 40 4 TYR A 134 ? ? -172.84 105.18 41 5 ARG A 14 ? ? 64.89 -74.72 42 5 ASP A 15 ? ? -148.44 16.35 43 5 MET A 42 ? ? -23.81 124.36 44 5 LYS A 58 ? ? 68.92 -69.82 45 5 LYS A 60 ? ? 70.29 -48.01 46 5 TYR A 61 ? ? -66.40 2.68 47 5 ASN A 62 ? ? -83.27 -153.63 48 5 ASP A 74 ? ? -179.00 -48.35 49 5 THR A 96 ? ? -171.72 -21.91 50 5 GLU A 97 ? ? 59.41 72.90 51 5 CYS A 114 ? ? -57.07 -8.65 52 5 HIS A 128 ? ? -170.15 142.14 53 5 SER A 132 ? ? 67.81 -167.72 54 5 ASN A 133 ? ? -145.83 -71.57 55 6 ARG A 14 ? ? 57.44 -97.54 56 6 MET A 42 ? ? -20.68 123.60 57 6 LYS A 58 ? ? 67.67 -73.65 58 6 LYS A 60 ? ? 78.33 -18.17 59 6 ASN A 62 ? ? -116.82 -167.70 60 6 ASP A 74 ? ? 179.52 -47.48 61 6 ASN A 98 ? ? -108.39 -167.24 62 6 CYS A 114 ? ? -47.89 -19.14 63 6 SER A 132 ? ? 77.18 150.80 64 6 ASN A 133 ? ? -103.12 -79.44 65 6 TYR A 134 ? ? 175.50 169.12 66 6 VAL A 135 ? ? -105.28 -70.44 67 6 TYR A 137 ? ? 68.35 -57.52 68 7 LYS A 3 ? ? 69.79 116.66 69 7 ARG A 14 ? ? 59.68 -81.50 70 7 ASP A 15 ? ? -143.61 18.60 71 7 MET A 42 ? ? -32.47 126.43 72 7 LYS A 58 ? ? 69.63 -67.84 73 7 LYS A 60 ? ? 79.14 -47.69 74 7 TYR A 61 ? ? -73.66 31.27 75 7 ASN A 62 ? ? -109.58 -162.93 76 7 ASP A 74 ? ? -175.72 -42.81 77 7 LYS A 91 ? ? -66.61 94.00 78 7 GLU A 97 ? ? 70.86 -4.89 79 7 CYS A 114 ? ? -49.95 -8.60 80 7 TYR A 134 ? ? -175.98 107.83 81 8 LYS A 3 ? ? 169.59 150.31 82 8 LEU A 4 ? ? -120.39 -91.60 83 8 ARG A 14 ? ? 52.15 -104.46 84 8 MET A 42 ? ? -23.66 123.17 85 8 LYS A 58 ? ? 70.29 -60.42 86 8 LYS A 60 ? ? 81.64 -20.64 87 8 ASP A 74 ? ? -179.08 -42.80 88 8 THR A 96 ? ? -144.22 -22.85 89 8 GLU A 97 ? ? 57.81 82.88 90 8 LEU A 131 ? ? 85.46 165.19 91 8 SER A 132 ? ? 72.28 175.14 92 8 ASN A 133 ? ? -150.73 -76.83 93 8 TYR A 134 ? ? -171.62 148.90 94 8 VAL A 135 ? ? -103.65 -62.15 95 9 ARG A 14 ? ? 50.50 -82.28 96 9 MET A 42 ? ? -23.37 123.39 97 9 LYS A 58 ? ? 70.72 -50.62 98 9 LYS A 60 ? ? 74.40 -35.18 99 9 TYR A 61 ? ? -77.55 37.58 100 9 ASP A 74 ? ? -176.91 -36.17 101 9 SER A 132 ? ? 62.42 -160.13 102 9 ASN A 133 ? ? -146.20 -56.67 103 9 TYR A 137 ? ? 76.32 -25.84 104 10 LYS A 3 ? ? 170.38 148.44 105 10 ARG A 14 ? ? 63.47 -102.88 106 10 MET A 42 ? ? -24.60 125.31 107 10 LYS A 58 ? ? 65.30 -72.29 108 10 LYS A 60 ? ? 75.03 -29.60 109 10 TYR A 61 ? ? -75.69 38.40 110 10 ASP A 74 ? ? 177.48 -44.39 111 10 LEU A 131 ? ? -175.70 138.57 112 10 SER A 132 ? ? 80.46 136.82 113 10 TYR A 134 ? ? 71.48 159.36 114 10 VAL A 135 ? ? -129.99 -78.34 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 119 ? ? 0.098 'SIDE CHAIN' 2 3 ARG A 119 ? ? 0.084 'SIDE CHAIN' 3 8 ARG A 51 ? ? 0.082 'SIDE CHAIN' #