data_2M9J # _entry.id 2M9J # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2M9J RCSB RCSB103379 BMRB 19296 WWPDB D_1000103379 # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 19296 BMRB unspecified . 2M9E PDB unspecified . 2M9F PDB unspecified . 2M9I PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M9J _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-06-10 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Enck, S.' 1 'Chen, W.' 2 'Price, J.L.' 3 'Powers, E.T.' 4 'Wong, C.' 5 'Dyson, H.J.' 6 'Kelly, J.W.' 7 # _citation.id primary _citation.title 'Structural and energetic basis of carbohydrate-aromatic packing interactions in proteins.' _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_volume 135 _citation.page_first 9877 _citation.page_last 9884 _citation.year 2013 _citation.journal_id_ASTM JACSAT _citation.country US _citation.journal_id_ISSN 0002-7863 _citation.journal_id_CSD 0004 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23742246 _citation.pdbx_database_id_DOI 10.1021/ja4040472 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chen, W.' 1 ? primary 'Enck, S.' 2 ? primary 'Price, J.L.' 3 ? primary 'Powers, D.L.' 4 ? primary 'Powers, E.T.' 5 ? primary 'Wong, C.H.' 6 ? primary 'Dyson, H.J.' 7 ? primary 'Kelly, J.W.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn 'Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1' 4022.507 1 ? 'S11F, S14N, R16T, W29F' 'MODIFIED WW DOMAIN (UNP RESIDUES 6-39)' ? 2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Peptidyl-prolyl cis-trans isomerase Pin1, PPIase Pin1, Rotamase Pin1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code KLPPGWEKRMFRSNGTVYYFNHITNASQFERPSG _entity_poly.pdbx_seq_one_letter_code_can KLPPGWEKRMFRSNGTVYYFNHITNASQFERPSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 LEU n 1 3 PRO n 1 4 PRO n 1 5 GLY n 1 6 TRP n 1 7 GLU n 1 8 LYS n 1 9 ARG n 1 10 MET n 1 11 PHE n 1 12 ARG n 1 13 SER n 1 14 ASN n 1 15 GLY n 1 16 THR n 1 17 VAL n 1 18 TYR n 1 19 TYR n 1 20 PHE n 1 21 ASN n 1 22 HIS n 1 23 ILE n 1 24 THR n 1 25 ASN n 1 26 ALA n 1 27 SER n 1 28 GLN n 1 29 PHE n 1 30 GLU n 1 31 ARG n 1 32 PRO n 1 33 SER n 1 34 GLY n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PIN1_HUMAN _struct_ref.pdbx_db_accession Q13526 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSG _struct_ref.pdbx_align_begin 6 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M9J _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 34 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q13526 _struct_ref_seq.db_align_beg 6 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 39 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 34 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2M9J PHE A 11 ? UNP Q13526 SER 16 'SEE REMARK 999' 11 1 1 2M9J ASN A 14 ? UNP Q13526 SER 19 'SEE REMARK 999' 14 2 1 2M9J THR A 16 ? UNP Q13526 ARG 21 'SEE REMARK 999' 16 3 1 2M9J PHE A 29 ? UNP Q13526 TRP 34 'SEE REMARK 999' 29 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H TOCSY' 1 2 1 '2D 1H-1H COSY' 1 3 1 '2D 1H-1H NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.08 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 285 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '500 uM Pin WW Domain Peptide, 50 mM sodium phosphate, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker DRX 1 'Bruker DRX' 750 Bruker DRX 2 'Bruker DRX' # _pdbx_nmr_refine.entry_id 2M9J _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 17 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M9J _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M9J _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollman' 'structure solution' Amber ? 1 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollman' refinement Amber ? 2 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2M9J _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M9J _struct.title 'NMR solution structure of Pin1 WW domain mutant 6-1g' _struct.pdbx_descriptor 'Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M9J _struct_keywords.pdbx_keywords ISOMERASE _struct_keywords.text 'N-glycosylation, Enhanced Aromatic Sequon, WW domain, CH-pi interaction, ISOMERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag one _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id ASN _struct_conn.ptnr1_label_seq_id 14 _struct_conn.ptnr1_label_atom_id ND2 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id NAG _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C1 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id ASN _struct_conn.ptnr1_auth_seq_id 14 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id NAG _struct_conn.ptnr2_auth_seq_id 101 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.458 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role N-Glycosylation # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 6 ? MET A 10 ? TRP A 6 MET A 10 A 2 VAL A 17 ? ASN A 21 ? VAL A 17 ASN A 21 A 3 SER A 27 ? GLN A 28 ? SER A 27 GLN A 28 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 9 ? N ARG A 9 O TYR A 18 ? O TYR A 18 A 2 3 N TYR A 19 ? N TYR A 19 O GLN A 28 ? O GLN A 28 # _atom_sites.entry_id 2M9J _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 TRP 6 6 6 TRP TRP A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 MET 10 10 10 MET MET A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 GLY 34 34 34 GLY GLY A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id NAG _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 101 _pdbx_nonpoly_scheme.auth_seq_num 35 _pdbx_nonpoly_scheme.pdb_mon_id NAG _pdbx_nonpoly_scheme.auth_mon_id NAG _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id ASN _pdbx_struct_mod_residue.label_seq_id 14 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id ASN _pdbx_struct_mod_residue.auth_seq_id 14 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id ASN _pdbx_struct_mod_residue.details 'GLYCOSYLATION SITE' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-06-26 2 'Structure model' 1 1 2013-07-03 3 'Structure model' 1 2 2013-07-17 4 'Structure model' 1 3 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp 2 4 'Structure model' entity 3 4 'Structure model' pdbx_chem_comp_identifier 4 4 'Structure model' pdbx_entity_nonpoly 5 4 'Structure model' pdbx_nmr_software 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_site 8 4 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_chem_comp.name' 2 4 'Structure model' '_chem_comp.type' 3 4 'Structure model' '_entity.pdbx_description' 4 4 'Structure model' '_pdbx_entity_nonpoly.name' 5 4 'Structure model' '_pdbx_nmr_software.name' 6 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 7 4 'Structure model' '_struct_conn.pdbx_role' # _pdbx_entry_details.entry_id 2M9J _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details 'THIS IS A PIN1 WW DOMAIN VARIANT' _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'Pin WW Domain Peptide-1' 500 ? uM ? 1 'sodium phosphate-2' 50 ? mM ? 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2M9J _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 360 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 60 _pdbx_nmr_constraints.NOE_long_range_total_count 177 _pdbx_nmr_constraints.NOE_medium_range_total_count 51 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 72 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HH A TYR 19 ? ? O A GLY 34 ? ? 1.40 2 1 O A ARG 12 ? ? HG A SER 13 ? ? 1.53 3 2 HH A TYR 19 ? ? OXT A GLY 34 ? ? 1.36 4 4 HH A TYR 19 ? ? O A SER 33 ? ? 1.53 5 5 O A PRO 32 ? ? HG A SER 33 ? ? 1.51 6 6 HH A TYR 19 ? ? OXT A GLY 34 ? ? 1.41 7 6 O A LYS 1 ? ? HG A SER 33 ? ? 1.47 8 6 O A ARG 12 ? ? HG A SER 13 ? ? 1.54 9 7 O A ARG 12 ? ? HG A SER 13 ? ? 1.53 10 8 O A ARG 12 ? ? HG A SER 13 ? ? 1.53 11 10 HH A TYR 19 ? ? O A GLY 34 ? ? 1.35 12 11 O A ARG 12 ? ? HG A SER 13 ? ? 1.55 13 12 O A PRO 32 ? ? HG A SER 33 ? ? 1.51 14 14 OE1 A GLU 7 ? ? HH A TYR 19 ? ? 1.42 15 14 O A ARG 12 ? ? HG A SER 13 ? ? 1.47 16 15 HH A TYR 19 ? ? O A GLY 34 ? ? 1.40 17 16 O A ARG 12 ? ? HG A SER 13 ? ? 1.50 18 17 O A ARG 12 ? ? HG A SER 13 ? ? 1.53 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 9 ? ? CZ A ARG 9 ? ? NH1 A ARG 9 ? ? 125.01 120.30 4.71 0.50 N 2 1 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH1 A ARG 31 ? ? 124.72 120.30 4.42 0.50 N 3 1 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH2 A ARG 31 ? ? 115.86 120.30 -4.44 0.50 N 4 2 NE A ARG 9 ? ? CZ A ARG 9 ? ? NH1 A ARG 9 ? ? 123.36 120.30 3.06 0.50 N 5 2 NE A ARG 9 ? ? CZ A ARG 9 ? ? NH2 A ARG 9 ? ? 117.21 120.30 -3.09 0.50 N 6 2 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 124.16 120.30 3.86 0.50 N 7 3 NE A ARG 9 ? ? CZ A ARG 9 ? ? NH1 A ARG 9 ? ? 126.07 120.30 5.77 0.50 N 8 4 NE A ARG 9 ? ? CZ A ARG 9 ? ? NH1 A ARG 9 ? ? 124.86 120.30 4.56 0.50 N 9 4 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 123.36 120.30 3.06 0.50 N 10 5 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 123.34 120.30 3.04 0.50 N 11 5 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH1 A ARG 31 ? ? 123.55 120.30 3.25 0.50 N 12 6 NE A ARG 9 ? ? CZ A ARG 9 ? ? NH1 A ARG 9 ? ? 124.78 120.30 4.48 0.50 N 13 6 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH1 A ARG 31 ? ? 123.45 120.30 3.15 0.50 N 14 7 NE A ARG 9 ? ? CZ A ARG 9 ? ? NH1 A ARG 9 ? ? 126.09 120.30 5.79 0.50 N 15 7 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH1 A ARG 31 ? ? 123.64 120.30 3.34 0.50 N 16 8 NE A ARG 9 ? ? CZ A ARG 9 ? ? NH1 A ARG 9 ? ? 124.95 120.30 4.65 0.50 N 17 8 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH1 A ARG 31 ? ? 125.02 120.30 4.72 0.50 N 18 9 NE A ARG 9 ? ? CZ A ARG 9 ? ? NH1 A ARG 9 ? ? 124.25 120.30 3.95 0.50 N 19 9 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH1 A ARG 31 ? ? 124.60 120.30 4.30 0.50 N 20 10 C A LEU 2 ? ? N A PRO 3 ? ? CA A PRO 3 ? ? 129.36 119.30 10.06 1.50 Y 21 10 NE A ARG 9 ? ? CZ A ARG 9 ? ? NH1 A ARG 9 ? ? 125.11 120.30 4.81 0.50 N 22 10 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 123.65 120.30 3.35 0.50 N 23 11 NE A ARG 9 ? ? CZ A ARG 9 ? ? NH1 A ARG 9 ? ? 124.60 120.30 4.30 0.50 N 24 12 NE A ARG 9 ? ? CZ A ARG 9 ? ? NH1 A ARG 9 ? ? 124.05 120.30 3.75 0.50 N 25 13 NE A ARG 9 ? ? CZ A ARG 9 ? ? NH1 A ARG 9 ? ? 124.13 120.30 3.83 0.50 N 26 14 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH2 A ARG 31 ? ? 117.14 120.30 -3.16 0.50 N 27 15 NE A ARG 9 ? ? CZ A ARG 9 ? ? NH1 A ARG 9 ? ? 125.85 120.30 5.55 0.50 N 28 15 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH2 A ARG 31 ? ? 117.12 120.30 -3.18 0.50 N 29 16 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH1 A ARG 31 ? ? 124.17 120.30 3.87 0.50 N 30 17 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH1 A ARG 31 ? ? 123.71 120.30 3.41 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 13 ? ? 80.94 -14.85 2 1 ASN A 25 ? ? 85.10 5.68 3 1 SER A 33 ? ? -114.09 -82.06 4 2 PRO A 4 ? ? -30.45 100.01 5 2 SER A 13 ? ? 66.11 -10.68 6 2 ASN A 14 ? ? -140.80 -21.12 7 2 SER A 33 ? ? -55.71 72.45 8 3 ASN A 25 ? ? 84.98 7.44 9 3 SER A 33 ? ? 175.19 72.72 10 4 ASN A 25 ? ? 85.13 7.61 11 5 SER A 13 ? ? 65.00 -5.91 12 5 ASN A 25 ? ? 85.15 6.29 13 5 SER A 33 ? ? 81.84 -91.91 14 6 SER A 13 ? ? 73.13 -9.99 15 6 ASN A 25 ? ? 82.90 8.33 16 6 SER A 33 ? ? -159.24 29.78 17 7 SER A 13 ? ? 89.43 -14.47 18 7 ASN A 25 ? ? 85.02 5.42 19 8 SER A 13 ? ? 73.82 -9.14 20 8 ASN A 25 ? ? 85.08 7.41 21 8 SER A 33 ? ? -69.42 81.69 22 9 SER A 13 ? ? 90.45 -13.33 23 9 ASN A 14 ? ? -143.36 -21.35 24 9 ASN A 25 ? ? 85.01 7.33 25 10 SER A 13 ? ? 65.84 -4.87 26 10 ASN A 25 ? ? 85.22 8.33 27 11 SER A 13 ? ? 72.31 -10.50 28 11 ASN A 25 ? ? 83.84 8.28 29 12 SER A 13 ? ? 67.26 -3.75 30 12 ASN A 14 ? ? -147.17 -21.09 31 12 PRO A 32 ? ? -57.53 179.15 32 12 SER A 33 ? ? 70.02 -80.62 33 13 SER A 13 ? ? 90.19 -7.83 34 13 ASN A 14 ? ? -141.71 -15.43 35 13 ASN A 25 ? ? 85.11 6.93 36 14 SER A 13 ? ? 90.32 -16.82 37 14 ASN A 14 ? ? -144.23 -19.56 38 14 HIS A 22 ? ? -65.99 2.00 39 14 ASN A 25 ? ? 85.02 11.97 40 15 SER A 13 ? ? 65.50 -4.10 41 15 ASN A 25 ? ? 85.06 6.55 42 15 SER A 33 ? ? -156.73 63.80 43 16 SER A 13 ? ? 90.04 -19.83 44 16 ASN A 14 ? ? -141.88 -20.31 45 16 ASN A 25 ? ? 85.08 7.52 46 16 SER A 33 ? ? 62.93 -66.99 47 17 SER A 13 ? ? 89.98 -16.24 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 9 ? ? 0.104 'SIDE CHAIN' 2 2 ARG A 31 ? ? 0.081 'SIDE CHAIN' 3 4 ARG A 9 ? ? 0.105 'SIDE CHAIN' 4 6 ARG A 9 ? ? 0.113 'SIDE CHAIN' 5 7 ARG A 31 ? ? 0.110 'SIDE CHAIN' 6 8 ARG A 9 ? ? 0.111 'SIDE CHAIN' 7 9 ARG A 9 ? ? 0.110 'SIDE CHAIN' 8 9 ARG A 31 ? ? 0.091 'SIDE CHAIN' 9 10 ARG A 9 ? ? 0.107 'SIDE CHAIN' 10 11 TYR A 19 ? ? 0.093 'SIDE CHAIN' 11 12 ARG A 9 ? ? 0.109 'SIDE CHAIN' 12 13 ARG A 9 ? ? 0.115 'SIDE CHAIN' 13 13 ARG A 31 ? ? 0.154 'SIDE CHAIN' 14 14 TYR A 18 ? ? 0.068 'SIDE CHAIN' 15 14 TYR A 19 ? ? 0.083 'SIDE CHAIN' 16 14 ARG A 31 ? ? 0.090 'SIDE CHAIN' 17 17 ARG A 31 ? ? 0.085 'SIDE CHAIN' # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 2-acetamido-2-deoxy-beta-D-glucopyranose _pdbx_entity_nonpoly.comp_id NAG #