data_2ME0 # _entry.id 2ME0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2ME0 pdb_00002me0 10.2210/pdb2me0/pdb RCSB RCSB103522 ? ? BMRB 19511 ? ? WWPDB D_1000103522 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 19511 BMRB unspecified . JCSG-424577 TargetTrack unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2ME0 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-09-20 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Proudfoot, A.' 1 'Serrano, P.' 2 'Geralt, M.' 3 'Wuthrich, K.' 4 'Joint Center for Structural Genomics (JCSG)' 5 'Partnership for Stem Cell Biology (STEMCELL)' 6 # _citation.id primary _citation.title ;NMR Structure of the homeodomain transcription factor Gbx1 from Homo sapiens solved in the presence of the DNA sequence CGACTAATTAGTCG ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Proudfoot, A.' 1 ? primary 'Wuthrich, K.' 2 ? primary 'Serrano, P.' 3 ? primary 'Geralt, M.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Homeobox protein GBX-1' _entity.formula_weight 8346.700 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Homeobox DNA binding region, residues 256-325' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Gastrulation and brain-specific homeobox protein 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SAPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRIKAGNVS _entity_poly.pdbx_seq_one_letter_code_can SAPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRIKAGNVS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier JCSG-424577 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ALA n 1 3 PRO n 1 4 GLY n 1 5 GLY n 1 6 LYS n 1 7 SER n 1 8 ARG n 1 9 ARG n 1 10 ARG n 1 11 ARG n 1 12 THR n 1 13 ALA n 1 14 PHE n 1 15 THR n 1 16 SER n 1 17 GLU n 1 18 GLN n 1 19 LEU n 1 20 LEU n 1 21 GLU n 1 22 LEU n 1 23 GLU n 1 24 LYS n 1 25 GLU n 1 26 PHE n 1 27 HIS n 1 28 CYS n 1 29 LYS n 1 30 LYS n 1 31 TYR n 1 32 LEU n 1 33 SER n 1 34 LEU n 1 35 THR n 1 36 GLU n 1 37 ARG n 1 38 SER n 1 39 GLN n 1 40 ILE n 1 41 ALA n 1 42 HIS n 1 43 ALA n 1 44 LEU n 1 45 LYS n 1 46 LEU n 1 47 SER n 1 48 GLU n 1 49 VAL n 1 50 GLN n 1 51 VAL n 1 52 LYS n 1 53 ILE n 1 54 TRP n 1 55 PHE n 1 56 GLN n 1 57 ASN n 1 58 ARG n 1 59 ARG n 1 60 ALA n 1 61 LYS n 1 62 TRP n 1 63 LYS n 1 64 ARG n 1 65 ILE n 1 66 LYS n 1 67 ALA n 1 68 GLY n 1 69 ASN n 1 70 VAL n 1 71 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene GBX1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector PET46 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GBX1_HUMAN _struct_ref.pdbx_db_accession Q14549 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code APGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRIKAGNVS _struct_ref.pdbx_align_begin 256 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2ME0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 71 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q14549 _struct_ref_seq.db_align_beg 256 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 325 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 71 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2ME0 _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q14549 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D 1H-13C NOESY aliphatic' 1 3 1 '3D 1H-13C NOESY aromatic' 1 4 1 '3D 1H-15N NOESY' 1 5 1 'APSY 4D-HACANH' 1 6 1 'APSY 5D-CBCACONH' 1 7 1 'APSY 5D-HACACONH' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.220 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.8 mM [U-98% 13C; U-98% 15N] protein, 50 mM sodium chloride, 20 mM sodium phosphate, 5 mM sodium azide, 0.8 mM DNA, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker AVANCE 1 'Bruker Avance' 800 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2ME0 _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 40 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2ME0 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2ME0 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert P.' refinement CYANA ? 1 'Guntert P.' 'chemical shift assignment' CYANA ? 2 'Keller and Wuthrich' refinement CARA ? 3 'Keller and Wuthrich' 'chemical shift assignment' CARA ? 4 'Luginbuhl, Guntert, Billeter and Wuthrich' refinement OPALp ? 5 'Herrmann and Wuthrich' 'structure solution' UNIO ? 6 'Herrmann and Wuthrich' 'chemical shift assignment' UNIO ? 7 'Bruker Biospin' processing TopSpin ? 8 'Bruker Biospin' collection TopSpin ? 9 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2ME0 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2ME0 _struct.title ;NMR Structure of the homeodomain transcription factor Gbx1 from Homo sapiens solved in the presence of the DNA sequence CGACTAATTAGTCG ; _struct.pdbx_model_details 'closest to the average, model4' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2ME0 _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text ;Homeodomain, DNA binding, TRANSCRIPTION, Structural Genomics, PSI-Biology, Joint Center for Structural Genomics, JCSG, Partnership for Stem Cell Biology, STEMCELL ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 18 ? LYS A 29 ? GLN A 18 LYS A 29 1 ? 12 HELX_P HELX_P2 2 SER A 33 ? LEU A 44 ? SER A 33 LEU A 44 1 ? 12 HELX_P HELX_P3 3 SER A 47 ? PHE A 55 ? SER A 47 PHE A 55 1 ? 9 HELX_P HELX_P4 4 GLN A 56 ? ARG A 58 ? GLN A 56 ARG A 58 5 ? 3 HELX_P HELX_P5 5 ARG A 59 ? LYS A 66 ? ARG A 59 LYS A 66 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2ME0 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O Q S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 HIS 42 42 42 HIS HIS A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 TRP 54 54 54 TRP TRP A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 TRP 62 62 62 TRP TRP A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 SER 71 71 71 SER SER A . n # loop_ _pdbx_SG_project.full_name_of_center _pdbx_SG_project.id _pdbx_SG_project.initial_of_center _pdbx_SG_project.project_name 'Joint Center for Structural Genomics' 1 JCSG PSI:Biology 'Partnership for Stem Cell Biology' 2 STEMCELL PSI:Biology # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-10-02 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 2 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' 6 2 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity-1 0.8 ? mM '[U-98% 13C; U-98% 15N]' 1 'sodium chloride-2' 50 ? mM ? 1 'sodium phosphate-3' 20 ? mM ? 1 'sodium azide-4' 5 ? mM ? 1 DNA-5 0.8 ? mM ? 1 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 2 NE A ARG 59 ? ? CZ A ARG 59 ? ? NH2 A ARG 59 ? ? 117.12 120.30 -3.18 0.50 N 2 14 NE A ARG 64 ? ? CZ A ARG 64 ? ? NH1 A ARG 64 ? ? 123.48 120.30 3.18 0.50 N 3 16 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH2 A ARG 8 ? ? 116.81 120.30 -3.49 0.50 N 4 18 NE A ARG 58 ? ? CZ A ARG 58 ? ? NH1 A ARG 58 ? ? 123.98 120.30 3.68 0.50 N 5 18 NE A ARG 58 ? ? CZ A ARG 58 ? ? NH2 A ARG 58 ? ? 116.69 120.30 -3.61 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 39 ? ? -67.78 -70.16 2 1 LEU A 44 ? ? -121.37 -88.45 3 1 LYS A 45 ? ? -158.96 10.92 4 1 LYS A 66 ? ? -75.74 48.48 5 2 PHE A 14 ? ? -129.24 -164.86 6 2 LEU A 44 ? ? -110.29 -89.15 7 2 LYS A 45 ? ? -167.35 1.79 8 2 ARG A 58 ? ? -66.01 8.00 9 2 LYS A 66 ? ? -72.30 42.15 10 3 ARG A 8 ? ? -53.88 109.03 11 3 SER A 33 ? ? -72.19 40.96 12 3 LEU A 34 ? ? 67.28 -67.02 13 3 LEU A 44 ? ? -108.02 -85.72 14 3 LYS A 45 ? ? 174.94 28.89 15 3 LYS A 52 ? ? -57.21 -7.60 16 4 ALA A 2 ? ? -161.46 66.88 17 4 ALA A 13 ? ? -91.20 57.81 18 4 LEU A 34 ? ? 58.39 -86.29 19 4 GLN A 39 ? ? -78.23 -84.43 20 4 LEU A 44 ? ? -117.96 -88.93 21 4 LYS A 45 ? ? -158.45 39.43 22 4 ARG A 58 ? ? -78.51 20.78 23 5 ARG A 10 ? ? -68.58 88.36 24 5 ALA A 13 ? ? -106.16 55.91 25 5 GLU A 25 ? ? -68.00 0.63 26 5 LEU A 34 ? ? 44.64 -76.60 27 5 LEU A 44 ? ? -109.11 -88.37 28 5 LYS A 45 ? ? -175.78 41.29 29 5 LYS A 66 ? ? -75.55 42.93 30 6 SER A 16 ? ? -54.58 -4.35 31 6 LEU A 34 ? ? 72.89 -56.00 32 6 GLN A 39 ? ? -88.55 -80.29 33 6 LEU A 44 ? ? -111.83 -89.73 34 6 LYS A 45 ? ? -165.96 31.59 35 6 ARG A 58 ? ? -63.20 0.31 36 7 ALA A 13 ? ? -140.16 38.64 37 7 LYS A 30 ? ? -65.77 11.35 38 7 LEU A 34 ? ? 43.42 -76.25 39 7 GLN A 39 ? ? -62.61 -73.19 40 7 LEU A 44 ? ? -92.92 -86.09 41 7 LYS A 45 ? ? 174.42 14.42 42 7 LYS A 66 ? ? -75.98 26.68 43 8 ARG A 8 ? ? 175.00 131.08 44 8 ALA A 13 ? ? -85.86 33.75 45 8 TYR A 31 ? ? -160.18 97.45 46 8 LEU A 32 ? ? -56.33 101.59 47 8 LEU A 34 ? ? 62.78 -86.11 48 8 LEU A 44 ? ? -97.21 -88.78 49 8 LYS A 45 ? ? -171.42 24.99 50 8 GLN A 56 ? ? -67.33 3.92 51 8 ASN A 69 ? ? -153.02 40.40 52 9 PHE A 14 ? ? -125.79 -166.02 53 9 CYS A 28 ? ? -137.16 -32.66 54 9 LYS A 30 ? ? -140.98 27.05 55 9 LEU A 32 ? ? -56.66 109.30 56 9 GLN A 39 ? ? -74.92 -80.18 57 9 ALA A 43 ? ? -126.04 -63.43 58 9 LEU A 44 ? ? -80.05 -86.95 59 9 LYS A 45 ? ? -164.83 8.76 60 10 ARG A 10 ? ? -65.47 88.71 61 10 ALA A 13 ? ? -112.54 52.47 62 10 PHE A 14 ? ? -120.32 -168.78 63 10 LYS A 30 ? ? -68.77 0.08 64 10 LEU A 44 ? ? -106.05 -89.15 65 10 LYS A 45 ? ? -169.61 7.67 66 10 LYS A 66 ? ? -75.14 35.34 67 10 ALA A 67 ? ? -68.25 -173.23 68 11 ARG A 11 ? ? -69.66 32.13 69 11 LEU A 34 ? ? 44.13 -86.10 70 11 LEU A 44 ? ? -88.57 -88.14 71 11 LYS A 45 ? ? -164.05 13.52 72 12 ALA A 2 ? ? -160.97 72.04 73 12 ARG A 10 ? ? -71.48 43.06 74 12 ALA A 13 ? ? -146.80 48.24 75 12 PHE A 14 ? ? -77.31 -165.92 76 12 SER A 33 ? ? -65.96 -179.28 77 12 LEU A 44 ? ? -119.41 -87.22 78 12 LYS A 45 ? ? 174.15 11.92 79 13 ARG A 10 ? ? -81.95 48.31 80 13 SER A 33 ? ? -68.51 96.77 81 13 LEU A 34 ? ? 43.54 -80.51 82 13 LEU A 44 ? ? -91.13 -89.50 83 13 LYS A 45 ? ? -169.97 24.18 84 13 LYS A 66 ? ? -72.47 27.52 85 13 ASN A 69 ? ? -150.46 86.38 86 14 ARG A 10 ? ? -75.40 35.38 87 14 ARG A 11 ? ? -66.11 20.86 88 14 LYS A 30 ? ? -93.66 32.07 89 14 TYR A 31 ? ? -163.19 -167.93 90 14 LEU A 44 ? ? -113.64 -90.07 91 14 LYS A 45 ? ? -171.49 33.83 92 14 GLN A 56 ? ? -67.53 10.75 93 14 ASN A 57 ? ? -126.41 -53.13 94 15 ALA A 2 ? ? -144.71 56.00 95 15 ARG A 10 ? ? -70.60 44.65 96 15 THR A 12 ? ? -65.09 -179.38 97 15 GLU A 25 ? ? -77.69 30.15 98 15 LYS A 30 ? ? -107.04 42.95 99 15 TYR A 31 ? ? -176.91 -174.08 100 15 ALA A 43 ? ? -142.25 -2.60 101 15 LYS A 45 ? ? -58.12 33.23 102 15 LEU A 46 ? ? -63.45 -179.54 103 15 LYS A 66 ? ? -76.31 47.39 104 16 ARG A 9 ? ? -75.28 30.33 105 16 ARG A 11 ? ? -77.26 49.04 106 16 LYS A 30 ? ? -80.45 39.94 107 16 TYR A 31 ? ? -171.93 138.83 108 16 SER A 33 ? ? -65.14 -179.31 109 16 LEU A 44 ? ? -101.77 -88.16 110 16 LYS A 45 ? ? -159.92 -1.21 111 17 ARG A 10 ? ? -64.26 92.33 112 17 THR A 35 ? ? 51.27 10.84 113 17 LEU A 44 ? ? -122.98 -86.06 114 17 LYS A 45 ? ? -179.44 43.46 115 17 LEU A 46 ? ? -113.08 -169.43 116 17 LYS A 61 ? ? -44.84 -72.79 117 17 LYS A 66 ? ? -73.12 23.09 118 17 ASN A 69 ? ? -62.37 -179.36 119 18 ARG A 10 ? ? -62.39 76.79 120 18 ARG A 11 ? ? -99.78 43.93 121 18 LEU A 44 ? ? -114.63 -88.25 122 18 LYS A 45 ? ? -155.10 13.67 123 18 ARG A 64 ? ? -58.38 -9.80 124 18 LYS A 66 ? ? -90.35 49.01 125 18 VAL A 70 ? ? -170.45 135.65 126 19 PRO A 3 ? ? -67.41 -176.24 127 19 LYS A 6 ? ? -174.64 92.65 128 19 LYS A 30 ? ? -76.39 35.72 129 19 TYR A 31 ? ? -164.54 103.33 130 19 THR A 35 ? ? 48.96 21.88 131 19 LEU A 44 ? ? -99.69 -88.34 132 19 LYS A 45 ? ? -159.46 4.72 133 19 ARG A 58 ? ? -71.02 28.61 134 19 ARG A 64 ? ? -54.20 -71.15 135 20 ARG A 8 ? ? -73.00 29.80 136 20 ALA A 13 ? ? -146.29 39.86 137 20 PHE A 14 ? ? -125.98 -165.29 138 20 GLU A 25 ? ? -63.07 1.35 139 20 LEU A 44 ? ? -96.93 -89.40 140 20 LYS A 45 ? ? -164.65 15.46 141 20 LYS A 66 ? ? -81.12 47.07 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 4 ARG A 8 ? ? ARG A 9 ? ? 140.28 2 11 VAL A 70 ? ? SER A 71 ? ? 120.92 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 3 TYR A 31 ? ? 0.088 'SIDE CHAIN' 2 3 ARG A 37 ? ? 0.081 'SIDE CHAIN' 3 6 ARG A 11 ? ? 0.128 'SIDE CHAIN' 4 6 ARG A 37 ? ? 0.230 'SIDE CHAIN' 5 7 ARG A 9 ? ? 0.092 'SIDE CHAIN' 6 10 ARG A 37 ? ? 0.115 'SIDE CHAIN' 7 11 ARG A 11 ? ? 0.086 'SIDE CHAIN' 8 13 ARG A 10 ? ? 0.099 'SIDE CHAIN' 9 14 TYR A 31 ? ? 0.070 'SIDE CHAIN' 10 15 ARG A 11 ? ? 0.096 'SIDE CHAIN' 11 15 PHE A 14 ? ? 0.079 'SIDE CHAIN' 12 18 ARG A 37 ? ? 0.082 'SIDE CHAIN' 13 19 ARG A 59 ? ? 0.088 'SIDE CHAIN' #