data_2MGL # _entry.id 2MGL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2MGL WWPDB D_1000178363 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2MGL _pdbx_database_status.recvd_initial_deposition_date 1993-05-10 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site ? _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Quillin, M.L.' 1 'Arduini, R.M.' 2 'Phillips Jr., G.N.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'High-resolution crystal structures of distal histidine mutants of sperm whale myoglobin.' J.Mol.Biol. 234 140 155 1993 JMOBAK UK 0022-2836 0070 ? 8230194 10.1006/jmbi.1993.1569 1 'Crystal Structure of Myoglobin from a Synthetic Gene' Proteins 7 358 ? 1990 PSFGEY US 0887-3585 0867 ? ? ? 2 'High-Level Expression of Sperm Whale Myoglobin in Escherichia Coli' Proc.Natl.Acad.Sci.USA 84 8961 ? 1987 PNASA6 US 0027-8424 0040 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Quillin, M.L.' 1 primary 'Arduini, R.M.' 2 primary 'Olson, J.S.' 3 primary 'Phillips Jr., G.N.' 4 1 'Phillips Jr., G.N.' 5 1 'Arduini, R.M.' 6 1 'Springer, B.A.' 7 1 'Sligar, S.G.' 8 2 'Springer, B.A.' 9 2 'Sligar, S.G.' 10 # _cell.entry_id 2MGL _cell.length_a 91.200 _cell.length_b 91.200 _cell.length_c 45.870 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2MGL _symmetry.space_group_name_H-M 'P 6' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 168 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man MYOGLOBIN 17365.164 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487 1 ? ? ? ? 4 water nat water 18.015 168 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKK GHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG ; _entity_poly.pdbx_seq_one_letter_code_can ;MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKK GHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 LEU n 1 4 SER n 1 5 GLU n 1 6 GLY n 1 7 GLU n 1 8 TRP n 1 9 GLN n 1 10 LEU n 1 11 VAL n 1 12 LEU n 1 13 HIS n 1 14 VAL n 1 15 TRP n 1 16 ALA n 1 17 LYS n 1 18 VAL n 1 19 GLU n 1 20 ALA n 1 21 ASP n 1 22 VAL n 1 23 ALA n 1 24 GLY n 1 25 HIS n 1 26 GLY n 1 27 GLN n 1 28 ASP n 1 29 ILE n 1 30 LEU n 1 31 ILE n 1 32 ARG n 1 33 LEU n 1 34 PHE n 1 35 LYS n 1 36 SER n 1 37 HIS n 1 38 PRO n 1 39 GLU n 1 40 THR n 1 41 LEU n 1 42 GLU n 1 43 LYS n 1 44 PHE n 1 45 ASP n 1 46 ARG n 1 47 PHE n 1 48 LYS n 1 49 HIS n 1 50 LEU n 1 51 LYS n 1 52 THR n 1 53 GLU n 1 54 ALA n 1 55 GLU n 1 56 MET n 1 57 LYS n 1 58 ALA n 1 59 SER n 1 60 GLU n 1 61 ASP n 1 62 LEU n 1 63 LYS n 1 64 LYS n 1 65 HIS n 1 66 GLY n 1 67 VAL n 1 68 THR n 1 69 VAL n 1 70 LEU n 1 71 THR n 1 72 ALA n 1 73 LEU n 1 74 GLY n 1 75 ALA n 1 76 ILE n 1 77 LEU n 1 78 LYS n 1 79 LYS n 1 80 LYS n 1 81 GLY n 1 82 HIS n 1 83 HIS n 1 84 GLU n 1 85 ALA n 1 86 GLU n 1 87 LEU n 1 88 LYS n 1 89 PRO n 1 90 LEU n 1 91 ALA n 1 92 GLN n 1 93 SER n 1 94 HIS n 1 95 ALA n 1 96 THR n 1 97 LYS n 1 98 HIS n 1 99 LYS n 1 100 ILE n 1 101 PRO n 1 102 ILE n 1 103 LYS n 1 104 TYR n 1 105 LEU n 1 106 GLU n 1 107 PHE n 1 108 ILE n 1 109 SER n 1 110 GLU n 1 111 ALA n 1 112 ILE n 1 113 ILE n 1 114 HIS n 1 115 VAL n 1 116 LEU n 1 117 HIS n 1 118 SER n 1 119 ARG n 1 120 HIS n 1 121 PRO n 1 122 GLY n 1 123 ASN n 1 124 PHE n 1 125 GLY n 1 126 ALA n 1 127 ASP n 1 128 ALA n 1 129 GLN n 1 130 GLY n 1 131 ALA n 1 132 MET n 1 133 ASN n 1 134 LYS n 1 135 ALA n 1 136 LEU n 1 137 GLU n 1 138 LEU n 1 139 PHE n 1 140 ARG n 1 141 LYS n 1 142 ASP n 1 143 ILE n 1 144 ALA n 1 145 ALA n 1 146 LYS n 1 147 TYR n 1 148 LYS n 1 149 GLU n 1 150 LEU n 1 151 GLY n 1 152 TYR n 1 153 GLN n 1 154 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'sperm whale' _entity_src_gen.gene_src_genus Physeter _entity_src_gen.pdbx_gene_src_gene 'SYNTHETIC GENE' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Physeter catodon' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9755 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MYG_PHYCA _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P02185 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKK GHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MGL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 154 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02185 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 154 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 153 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEM non-polymer . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2MGL _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.17 _exptl_crystal.density_percent_sol 61.20 _exptl_crystal.description ? # _refine.entry_id 2MGL _refine.ls_number_reflns_obs 12512 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 5.0 _refine.ls_d_res_high 2.0 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.1440000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1440000 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1225 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 48 _refine_hist.number_atoms_solvent 168 _refine_hist.number_atoms_total 1441 _refine_hist.d_res_high 2.0 _refine_hist.d_res_low 5.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.019 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 2.442 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 21.90 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 5.240 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 2MGL _struct.title 'HIGH RESOLUTION CRYSTAL STRUCTURES OF FIVE DISTAL HISTIDINE MUTANTS OF SPERM WHALE MYOGLOBIN' _struct.pdbx_descriptor 'MYOGLOBIN (DEOXY) MUTANT WITH INITIATOR MET AND ASP 122 REPLACED BY ASN (MET,D122N)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MGL _struct_keywords.pdbx_keywords 'OXYGEN STORAGE' _struct_keywords.text 'OXYGEN STORAGE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 A SER A 4 ? GLU A 19 ? SER A 3 GLU A 18 1 ? 16 HELX_P HELX_P2 B ASP A 21 ? SER A 36 ? ASP A 20 SER A 35 1 ? 16 HELX_P HELX_P3 C HIS A 37 ? LYS A 43 ? HIS A 36 LYS A 42 1 ? 7 HELX_P HELX_P4 D THR A 52 ? ALA A 58 ? THR A 51 ALA A 57 1 ? 7 HELX_P HELX_P5 E SER A 59 ? LYS A 78 ? SER A 58 LYS A 77 1 ? 20 HELX_P HELX_P6 F LEU A 87 ? THR A 96 ? LEU A 86 THR A 95 1 'BREAK AT PRO 88' 10 HELX_P HELX_P7 G PRO A 101 ? ARG A 119 ? PRO A 100 ARG A 118 1 ? 19 HELX_P HELX_P8 H GLY A 125 ? LEU A 150 ? GLY A 124 LEU A 149 1 ? 26 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id metalc1 _struct_conn.conn_type_id metalc _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id C _struct_conn.ptnr1_label_comp_id HEM _struct_conn.ptnr1_label_seq_id . _struct_conn.ptnr1_label_atom_id FE _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id HIS _struct_conn.ptnr2_label_seq_id 94 _struct_conn.ptnr2_label_atom_id NE2 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id HEM _struct_conn.ptnr1_auth_seq_id 154 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id HIS _struct_conn.ptnr2_auth_seq_id 93 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.245 _struct_conn.pdbx_value_order ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 A 156' AC2 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE HEM A 154' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 SER A 4 ? SER A 3 . ? 1_556 ? 2 AC1 6 GLU A 5 ? GLU A 4 . ? 1_556 ? 3 AC1 6 THR A 52 ? THR A 51 . ? 1_555 ? 4 AC1 6 GLU A 53 ? GLU A 52 . ? 1_555 ? 5 AC1 6 HOH D . ? HOH A 224 . ? 1_556 ? 6 AC1 6 HOH D . ? HOH A 235 . ? 1_555 ? 7 AC2 16 THR A 40 ? THR A 39 . ? 1_555 ? 8 AC2 16 LYS A 43 ? LYS A 42 . ? 1_555 ? 9 AC2 16 PHE A 44 ? PHE A 43 . ? 1_555 ? 10 AC2 16 ARG A 46 ? ARG A 45 . ? 1_555 ? 11 AC2 16 HIS A 65 ? HIS A 64 . ? 1_555 ? 12 AC2 16 THR A 68 ? THR A 67 . ? 1_555 ? 13 AC2 16 LEU A 90 ? LEU A 89 . ? 1_555 ? 14 AC2 16 SER A 93 ? SER A 92 . ? 1_555 ? 15 AC2 16 HIS A 94 ? HIS A 93 . ? 1_555 ? 16 AC2 16 HIS A 98 ? HIS A 97 . ? 1_555 ? 17 AC2 16 ILE A 100 ? ILE A 99 . ? 1_555 ? 18 AC2 16 TYR A 104 ? TYR A 103 . ? 1_555 ? 19 AC2 16 HOH D . ? HOH A 259 . ? 1_555 ? 20 AC2 16 HOH D . ? HOH A 271 . ? 1_555 ? 21 AC2 16 HOH D . ? HOH A 324 . ? 1_555 ? 22 AC2 16 HOH D . ? HOH A 358 . ? 1_555 ? # _database_PDB_matrix.entry_id 2MGL _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2MGL _atom_sites.fract_transf_matrix[1][1] 0.010965 _atom_sites.fract_transf_matrix[1][2] 0.006331 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012661 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.021801 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 0 MET MET A . n A 1 2 VAL 2 1 1 VAL VAL A . n A 1 3 LEU 3 2 2 LEU LEU A . n A 1 4 SER 4 3 3 SER SER A . n A 1 5 GLU 5 4 4 GLU GLU A . n A 1 6 GLY 6 5 5 GLY GLY A . n A 1 7 GLU 7 6 6 GLU GLU A . n A 1 8 TRP 8 7 7 TRP TRP A . n A 1 9 GLN 9 8 8 GLN GLN A . n A 1 10 LEU 10 9 9 LEU LEU A . n A 1 11 VAL 11 10 10 VAL VAL A . n A 1 12 LEU 12 11 11 LEU LEU A . n A 1 13 HIS 13 12 12 HIS HIS A . n A 1 14 VAL 14 13 13 VAL VAL A . n A 1 15 TRP 15 14 14 TRP TRP A . n A 1 16 ALA 16 15 15 ALA ALA A . n A 1 17 LYS 17 16 16 LYS LYS A . n A 1 18 VAL 18 17 17 VAL VAL A . n A 1 19 GLU 19 18 18 GLU GLU A . n A 1 20 ALA 20 19 19 ALA ALA A . n A 1 21 ASP 21 20 20 ASP ASP A . n A 1 22 VAL 22 21 21 VAL VAL A . n A 1 23 ALA 23 22 22 ALA ALA A . n A 1 24 GLY 24 23 23 GLY GLY A . n A 1 25 HIS 25 24 24 HIS HIS A . n A 1 26 GLY 26 25 25 GLY GLY A . n A 1 27 GLN 27 26 26 GLN GLN A . n A 1 28 ASP 28 27 27 ASP ASP A . n A 1 29 ILE 29 28 28 ILE ILE A . n A 1 30 LEU 30 29 29 LEU LEU A . n A 1 31 ILE 31 30 30 ILE ILE A . n A 1 32 ARG 32 31 31 ARG ARG A . n A 1 33 LEU 33 32 32 LEU LEU A . n A 1 34 PHE 34 33 33 PHE PHE A . n A 1 35 LYS 35 34 34 LYS LYS A . n A 1 36 SER 36 35 35 SER SER A . n A 1 37 HIS 37 36 36 HIS HIS A . n A 1 38 PRO 38 37 37 PRO PRO A . n A 1 39 GLU 39 38 38 GLU GLU A . n A 1 40 THR 40 39 39 THR THR A . n A 1 41 LEU 41 40 40 LEU LEU A . n A 1 42 GLU 42 41 41 GLU GLU A . n A 1 43 LYS 43 42 42 LYS LYS A . n A 1 44 PHE 44 43 43 PHE PHE A . n A 1 45 ASP 45 44 44 ASP ASP A . n A 1 46 ARG 46 45 45 ARG ARG A . n A 1 47 PHE 47 46 46 PHE PHE A . n A 1 48 LYS 48 47 47 LYS LYS A . n A 1 49 HIS 49 48 48 HIS HIS A . n A 1 50 LEU 50 49 49 LEU LEU A . n A 1 51 LYS 51 50 50 LYS LYS A . n A 1 52 THR 52 51 51 THR THR A . n A 1 53 GLU 53 52 52 GLU GLU A . n A 1 54 ALA 54 53 53 ALA ALA A . n A 1 55 GLU 55 54 54 GLU GLU A . n A 1 56 MET 56 55 55 MET MET A . n A 1 57 LYS 57 56 56 LYS LYS A . n A 1 58 ALA 58 57 57 ALA ALA A . n A 1 59 SER 59 58 58 SER SER A . n A 1 60 GLU 60 59 59 GLU GLU A . n A 1 61 ASP 61 60 60 ASP ASP A . n A 1 62 LEU 62 61 61 LEU LEU A . n A 1 63 LYS 63 62 62 LYS LYS A . n A 1 64 LYS 64 63 63 LYS LYS A . n A 1 65 HIS 65 64 64 HIS HIS A . n A 1 66 GLY 66 65 65 GLY GLY A . n A 1 67 VAL 67 66 66 VAL VAL A . n A 1 68 THR 68 67 67 THR THR A . n A 1 69 VAL 69 68 68 VAL VAL A . n A 1 70 LEU 70 69 69 LEU LEU A . n A 1 71 THR 71 70 70 THR THR A . n A 1 72 ALA 72 71 71 ALA ALA A . n A 1 73 LEU 73 72 72 LEU LEU A . n A 1 74 GLY 74 73 73 GLY GLY A . n A 1 75 ALA 75 74 74 ALA ALA A . n A 1 76 ILE 76 75 75 ILE ILE A . n A 1 77 LEU 77 76 76 LEU LEU A . n A 1 78 LYS 78 77 77 LYS LYS A . n A 1 79 LYS 79 78 78 LYS LYS A . n A 1 80 LYS 80 79 79 LYS LYS A . n A 1 81 GLY 81 80 80 GLY GLY A . n A 1 82 HIS 82 81 81 HIS HIS A . n A 1 83 HIS 83 82 82 HIS HIS A . n A 1 84 GLU 84 83 83 GLU GLU A . n A 1 85 ALA 85 84 84 ALA ALA A . n A 1 86 GLU 86 85 85 GLU GLU A . n A 1 87 LEU 87 86 86 LEU LEU A . n A 1 88 LYS 88 87 87 LYS LYS A . n A 1 89 PRO 89 88 88 PRO PRO A . n A 1 90 LEU 90 89 89 LEU LEU A . n A 1 91 ALA 91 90 90 ALA ALA A . n A 1 92 GLN 92 91 91 GLN GLN A . n A 1 93 SER 93 92 92 SER SER A . n A 1 94 HIS 94 93 93 HIS HIS A . n A 1 95 ALA 95 94 94 ALA ALA A . n A 1 96 THR 96 95 95 THR THR A . n A 1 97 LYS 97 96 96 LYS LYS A . n A 1 98 HIS 98 97 97 HIS HIS A . n A 1 99 LYS 99 98 98 LYS LYS A . n A 1 100 ILE 100 99 99 ILE ILE A . n A 1 101 PRO 101 100 100 PRO PRO A . n A 1 102 ILE 102 101 101 ILE ILE A . n A 1 103 LYS 103 102 102 LYS LYS A . n A 1 104 TYR 104 103 103 TYR TYR A . n A 1 105 LEU 105 104 104 LEU LEU A . n A 1 106 GLU 106 105 105 GLU GLU A . n A 1 107 PHE 107 106 106 PHE PHE A . n A 1 108 ILE 108 107 107 ILE ILE A . n A 1 109 SER 109 108 108 SER SER A . n A 1 110 GLU 110 109 109 GLU GLU A . n A 1 111 ALA 111 110 110 ALA ALA A . n A 1 112 ILE 112 111 111 ILE ILE A . n A 1 113 ILE 113 112 112 ILE ILE A . n A 1 114 HIS 114 113 113 HIS HIS A . n A 1 115 VAL 115 114 114 VAL VAL A . n A 1 116 LEU 116 115 115 LEU LEU A . n A 1 117 HIS 117 116 116 HIS HIS A . n A 1 118 SER 118 117 117 SER SER A . n A 1 119 ARG 119 118 118 ARG ARG A . n A 1 120 HIS 120 119 119 HIS HIS A . n A 1 121 PRO 121 120 120 PRO PRO A . n A 1 122 GLY 122 121 121 GLY GLY A . n A 1 123 ASN 123 122 122 ASN ASN A . n A 1 124 PHE 124 123 123 PHE PHE A . n A 1 125 GLY 125 124 124 GLY GLY A . n A 1 126 ALA 126 125 125 ALA ALA A . n A 1 127 ASP 127 126 126 ASP ASP A . n A 1 128 ALA 128 127 127 ALA ALA A . n A 1 129 GLN 129 128 128 GLN GLN A . n A 1 130 GLY 130 129 129 GLY GLY A . n A 1 131 ALA 131 130 130 ALA ALA A . n A 1 132 MET 132 131 131 MET MET A . n A 1 133 ASN 133 132 132 ASN ASN A . n A 1 134 LYS 134 133 133 LYS LYS A . n A 1 135 ALA 135 134 134 ALA ALA A . n A 1 136 LEU 136 135 135 LEU LEU A . n A 1 137 GLU 137 136 136 GLU GLU A . n A 1 138 LEU 138 137 137 LEU LEU A . n A 1 139 PHE 139 138 138 PHE PHE A . n A 1 140 ARG 140 139 139 ARG ARG A . n A 1 141 LYS 141 140 140 LYS LYS A . n A 1 142 ASP 142 141 141 ASP ASP A . n A 1 143 ILE 143 142 142 ILE ILE A . n A 1 144 ALA 144 143 143 ALA ALA A . n A 1 145 ALA 145 144 144 ALA ALA A . n A 1 146 LYS 146 145 145 LYS LYS A . n A 1 147 TYR 147 146 146 TYR TYR A . n A 1 148 LYS 148 147 147 LYS LYS A . n A 1 149 GLU 149 148 148 GLU GLU A . n A 1 150 LEU 150 149 149 LEU LEU A . n A 1 151 GLY 151 150 150 GLY GLY A . n A 1 152 TYR 152 151 151 TYR TYR A . n A 1 153 GLN 153 152 152 GLN GLN A . n A 1 154 GLY 154 153 153 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 156 156 SO4 SO4 A . C 3 HEM 1 154 154 HEM HEM A . D 4 HOH 1 200 200 HOH HOH A . D 4 HOH 2 201 201 HOH HOH A . D 4 HOH 3 202 202 HOH HOH A . D 4 HOH 4 203 203 HOH HOH A . D 4 HOH 5 204 204 HOH HOH A . D 4 HOH 6 205 205 HOH HOH A . D 4 HOH 7 206 206 HOH HOH A . D 4 HOH 8 207 207 HOH HOH A . D 4 HOH 9 208 208 HOH HOH A . D 4 HOH 10 209 209 HOH HOH A . D 4 HOH 11 210 210 HOH HOH A . D 4 HOH 12 211 211 HOH HOH A . D 4 HOH 13 212 212 HOH HOH A . D 4 HOH 14 213 213 HOH HOH A . D 4 HOH 15 214 214 HOH HOH A . D 4 HOH 16 215 215 HOH HOH A . D 4 HOH 17 216 216 HOH HOH A . D 4 HOH 18 217 217 HOH HOH A . D 4 HOH 19 218 218 HOH HOH A . D 4 HOH 20 219 219 HOH HOH A . D 4 HOH 21 220 220 HOH HOH A . D 4 HOH 22 221 221 HOH HOH A . D 4 HOH 23 222 222 HOH HOH A . D 4 HOH 24 223 223 HOH HOH A . D 4 HOH 25 224 224 HOH HOH A . D 4 HOH 26 225 225 HOH HOH A . D 4 HOH 27 226 226 HOH HOH A . D 4 HOH 28 227 227 HOH HOH A . D 4 HOH 29 228 228 HOH HOH A . D 4 HOH 30 229 229 HOH HOH A . D 4 HOH 31 230 230 HOH HOH A . D 4 HOH 32 231 231 HOH HOH A . D 4 HOH 33 232 232 HOH HOH A . D 4 HOH 34 233 233 HOH HOH A . D 4 HOH 35 234 234 HOH HOH A . D 4 HOH 36 235 235 HOH HOH A . D 4 HOH 37 236 236 HOH HOH A . D 4 HOH 38 237 237 HOH HOH A . D 4 HOH 39 238 238 HOH HOH A . D 4 HOH 40 239 239 HOH HOH A . D 4 HOH 41 240 240 HOH HOH A . D 4 HOH 42 241 241 HOH HOH A . D 4 HOH 43 242 242 HOH HOH A . D 4 HOH 44 243 243 HOH HOH A . D 4 HOH 45 244 244 HOH HOH A . D 4 HOH 46 245 245 HOH HOH A . D 4 HOH 47 246 246 HOH HOH A . D 4 HOH 48 247 247 HOH HOH A . D 4 HOH 49 248 248 HOH HOH A . D 4 HOH 50 249 249 HOH HOH A . D 4 HOH 51 250 250 HOH HOH A . D 4 HOH 52 251 251 HOH HOH A . D 4 HOH 53 252 252 HOH HOH A . D 4 HOH 54 253 253 HOH HOH A . D 4 HOH 55 254 254 HOH HOH A . D 4 HOH 56 255 255 HOH HOH A . D 4 HOH 57 256 256 HOH HOH A . D 4 HOH 58 257 257 HOH HOH A . D 4 HOH 59 258 258 HOH HOH A . D 4 HOH 60 259 259 HOH HOH A . D 4 HOH 61 260 260 HOH HOH A . D 4 HOH 62 261 261 HOH HOH A . D 4 HOH 63 262 262 HOH HOH A . D 4 HOH 64 263 263 HOH HOH A . D 4 HOH 65 264 264 HOH HOH A . D 4 HOH 66 265 265 HOH HOH A . D 4 HOH 67 266 266 HOH HOH A . D 4 HOH 68 267 267 HOH HOH A . D 4 HOH 69 268 268 HOH HOH A . D 4 HOH 70 269 269 HOH HOH A . D 4 HOH 71 270 270 HOH HOH A . D 4 HOH 72 271 271 HOH HOH A . D 4 HOH 73 272 272 HOH HOH A . D 4 HOH 74 273 273 HOH HOH A . D 4 HOH 75 274 274 HOH HOH A . D 4 HOH 76 275 275 HOH HOH A . D 4 HOH 77 276 276 HOH HOH A . D 4 HOH 78 277 277 HOH HOH A . D 4 HOH 79 278 278 HOH HOH A . D 4 HOH 80 279 279 HOH HOH A . D 4 HOH 81 280 280 HOH HOH A . D 4 HOH 82 281 281 HOH HOH A . D 4 HOH 83 282 282 HOH HOH A . D 4 HOH 84 283 283 HOH HOH A . D 4 HOH 85 284 284 HOH HOH A . D 4 HOH 86 285 285 HOH HOH A . D 4 HOH 87 286 286 HOH HOH A . D 4 HOH 88 287 287 HOH HOH A . D 4 HOH 89 288 288 HOH HOH A . D 4 HOH 90 289 289 HOH HOH A . D 4 HOH 91 290 290 HOH HOH A . D 4 HOH 92 291 291 HOH HOH A . D 4 HOH 93 292 292 HOH HOH A . D 4 HOH 94 293 293 HOH HOH A . D 4 HOH 95 294 294 HOH HOH A . D 4 HOH 96 295 295 HOH HOH A . D 4 HOH 97 296 296 HOH HOH A . D 4 HOH 98 297 297 HOH HOH A . D 4 HOH 99 298 298 HOH HOH A . D 4 HOH 100 299 299 HOH HOH A . D 4 HOH 101 300 300 HOH HOH A . D 4 HOH 102 301 301 HOH HOH A . D 4 HOH 103 302 302 HOH HOH A . D 4 HOH 104 303 303 HOH HOH A . D 4 HOH 105 304 304 HOH HOH A . D 4 HOH 106 305 305 HOH HOH A . D 4 HOH 107 306 306 HOH HOH A . D 4 HOH 108 307 307 HOH HOH A . D 4 HOH 109 308 308 HOH HOH A . D 4 HOH 110 309 309 HOH HOH A . D 4 HOH 111 310 310 HOH HOH A . D 4 HOH 112 311 311 HOH HOH A . D 4 HOH 113 312 312 HOH HOH A . D 4 HOH 114 313 313 HOH HOH A . D 4 HOH 115 314 314 HOH HOH A . D 4 HOH 116 315 315 HOH HOH A . D 4 HOH 117 316 316 HOH HOH A . D 4 HOH 118 317 317 HOH HOH A . D 4 HOH 119 318 318 HOH HOH A . D 4 HOH 120 319 319 HOH HOH A . D 4 HOH 121 320 320 HOH HOH A . D 4 HOH 122 321 321 HOH HOH A . D 4 HOH 123 322 322 HOH HOH A . D 4 HOH 124 323 323 HOH HOH A . D 4 HOH 125 324 324 HOH HOH A . D 4 HOH 126 325 325 HOH HOH A . D 4 HOH 127 326 326 HOH HOH A . D 4 HOH 128 327 327 HOH HOH A . D 4 HOH 129 328 328 HOH HOH A . D 4 HOH 130 329 329 HOH HOH A . D 4 HOH 131 330 330 HOH HOH A . D 4 HOH 132 331 331 HOH HOH A . D 4 HOH 133 332 332 HOH HOH A . D 4 HOH 134 333 333 HOH HOH A . D 4 HOH 135 334 334 HOH HOH A . D 4 HOH 136 335 335 HOH HOH A . D 4 HOH 137 336 336 HOH HOH A . D 4 HOH 138 337 337 HOH HOH A . D 4 HOH 139 338 338 HOH HOH A . D 4 HOH 140 339 339 HOH HOH A . D 4 HOH 141 340 340 HOH HOH A . D 4 HOH 142 341 341 HOH HOH A . D 4 HOH 143 342 342 HOH HOH A . D 4 HOH 144 343 343 HOH HOH A . D 4 HOH 145 344 344 HOH HOH A . D 4 HOH 146 345 345 HOH HOH A . D 4 HOH 147 346 346 HOH HOH A . D 4 HOH 148 347 347 HOH HOH A . D 4 HOH 149 348 348 HOH HOH A . D 4 HOH 150 349 349 HOH HOH A . D 4 HOH 151 350 350 HOH HOH A . D 4 HOH 152 351 351 HOH HOH A . D 4 HOH 153 352 352 HOH HOH A . D 4 HOH 154 353 353 HOH HOH A . D 4 HOH 155 354 354 HOH HOH A . D 4 HOH 156 355 355 HOH HOH A . D 4 HOH 157 356 356 HOH HOH A . D 4 HOH 158 357 357 HOH HOH A . D 4 HOH 159 358 358 HOH HOH A . D 4 HOH 160 359 359 HOH HOH A . D 4 HOH 161 360 360 HOH HOH A . D 4 HOH 162 361 361 HOH HOH A . D 4 HOH 163 362 362 HOH HOH A . D 4 HOH 164 363 363 HOH HOH A . D 4 HOH 165 364 364 HOH HOH A . D 4 HOH 166 365 365 HOH HOH A . D 4 HOH 167 366 366 HOH HOH A . D 4 HOH 168 367 367 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 94 ? A HIS 93 ? 1_555 FE ? C HEM . ? A HEM 154 ? 1_555 NA ? C HEM . ? A HEM 154 ? 1_555 93.9 ? 2 NE2 ? A HIS 94 ? A HIS 93 ? 1_555 FE ? C HEM . ? A HEM 154 ? 1_555 NB ? C HEM . ? A HEM 154 ? 1_555 103.4 ? 3 NA ? C HEM . ? A HEM 154 ? 1_555 FE ? C HEM . ? A HEM 154 ? 1_555 NB ? C HEM . ? A HEM 154 ? 1_555 93.6 ? 4 NE2 ? A HIS 94 ? A HIS 93 ? 1_555 FE ? C HEM . ? A HEM 154 ? 1_555 NC ? C HEM . ? A HEM 154 ? 1_555 103.4 ? 5 NA ? C HEM . ? A HEM 154 ? 1_555 FE ? C HEM . ? A HEM 154 ? 1_555 NC ? C HEM . ? A HEM 154 ? 1_555 161.0 ? 6 NB ? C HEM . ? A HEM 154 ? 1_555 FE ? C HEM . ? A HEM 154 ? 1_555 NC ? C HEM . ? A HEM 154 ? 1_555 90.0 ? 7 NE2 ? A HIS 94 ? A HIS 93 ? 1_555 FE ? C HEM . ? A HEM 154 ? 1_555 ND ? C HEM . ? A HEM 154 ? 1_555 95.9 ? 8 NA ? C HEM . ? A HEM 154 ? 1_555 FE ? C HEM . ? A HEM 154 ? 1_555 ND ? C HEM . ? A HEM 154 ? 1_555 83.5 ? 9 NB ? C HEM . ? A HEM 154 ? 1_555 FE ? C HEM . ? A HEM 154 ? 1_555 ND ? C HEM . ? A HEM 154 ? 1_555 160.7 ? 10 NC ? C HEM . ? A HEM 154 ? 1_555 FE ? C HEM . ? A HEM 154 ? 1_555 ND ? C HEM . ? A HEM 154 ? 1_555 86.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1994-01-31 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CG A HIS 24 ? ? CD2 A HIS 24 ? ? 1.425 1.354 0.071 0.009 N 2 1 CG A HIS 82 ? ? CD2 A HIS 82 ? ? 1.430 1.354 0.076 0.009 N 3 1 CG A HIS 116 ? ? CD2 A HIS 116 ? ? 1.443 1.354 0.089 0.009 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CD1 A TRP 7 ? ? CG A TRP 7 ? ? CD2 A TRP 7 ? ? 112.73 106.30 6.43 0.80 N 2 1 CE2 A TRP 7 ? ? CD2 A TRP 7 ? ? CG A TRP 7 ? ? 101.79 107.30 -5.51 0.80 N 3 1 CD1 A TRP 14 ? ? CG A TRP 14 ? ? CD2 A TRP 14 ? ? 112.57 106.30 6.27 0.80 N 4 1 CE2 A TRP 14 ? ? CD2 A TRP 14 ? ? CG A TRP 14 ? ? 102.16 107.30 -5.14 0.80 N 5 1 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH2 A ARG 31 ? ? 116.53 120.30 -3.77 0.50 N 6 1 CB A HIS 48 ? ? CG A HIS 48 ? ? CD2 A HIS 48 ? ? 119.69 129.70 -10.01 1.60 N 7 1 CB A HIS 64 ? ? CG A HIS 64 ? ? CD2 A HIS 64 ? ? 117.00 129.70 -12.70 1.60 N 8 1 CE1 A HIS 64 ? ? NE2 A HIS 64 ? ? CD2 A HIS 64 ? ? 114.77 109.00 5.77 0.70 N 9 1 CG A HIS 64 ? ? CD2 A HIS 64 ? ? NE2 A HIS 64 ? ? 96.66 106.70 -10.04 1.20 N 10 1 CB A HIS 81 ? ? CG A HIS 81 ? ? CD2 A HIS 81 ? ? 117.86 129.70 -11.84 1.60 N 11 1 CE1 A HIS 81 ? ? NE2 A HIS 81 ? ? CD2 A HIS 81 ? ? 115.53 109.00 6.53 0.70 N 12 1 CE1 A HIS 93 ? ? NE2 A HIS 93 ? ? CD2 A HIS 93 ? ? 114.18 109.00 5.18 0.70 N 13 1 CE1 A HIS 97 ? ? NE2 A HIS 97 ? ? CD2 A HIS 97 ? ? 116.69 109.00 7.69 0.70 N 14 1 CB A HIS 113 ? ? CG A HIS 113 ? ? CD2 A HIS 113 ? ? 113.74 129.70 -15.96 1.60 N 15 1 CB A HIS 113 ? ? CG A HIS 113 ? ? ND1 A HIS 113 ? ? 141.99 123.20 18.79 2.50 N 16 1 CE1 A HIS 116 ? ? NE2 A HIS 116 ? ? CD2 A HIS 116 ? ? 113.94 109.00 4.94 0.70 N 17 1 NE A ARG 118 ? ? CZ A ARG 118 ? ? NH1 A ARG 118 ? ? 117.26 120.30 -3.04 0.50 N 18 1 NE A ARG 118 ? ? CZ A ARG 118 ? ? NH2 A ARG 118 ? ? 115.96 120.30 -4.34 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 47 ? ? -18.33 -55.77 2 1 LYS A 98 ? ? 69.04 71.28 3 1 GLN A 152 ? ? 18.56 71.60 # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 1 LEU A 11 ? ? -11.50 2 1 HIS A 24 ? ? 12.79 3 1 ARG A 31 ? ? -11.76 4 1 PHE A 33 ? ? 15.65 5 1 HIS A 36 ? ? -10.95 6 1 GLU A 38 ? ? -10.75 7 1 ASP A 44 ? ? -13.35 8 1 ARG A 45 ? ? 10.34 9 1 PHE A 46 ? ? 21.58 10 1 LYS A 47 ? ? 18.06 11 1 ASP A 60 ? ? 10.97 12 1 LYS A 63 ? ? 11.05 13 1 ILE A 75 ? ? -11.22 14 1 HIS A 82 ? ? 10.70 15 1 ALA A 84 ? ? 11.34 16 1 ALA A 94 ? ? -13.90 17 1 LYS A 96 ? ? -12.71 18 1 HIS A 97 ? ? 12.00 19 1 PHE A 123 ? ? 10.80 20 1 GLN A 152 ? ? 12.86 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ASP A 27 ? ? 0.081 'SIDE CHAIN' 2 1 GLU A 54 ? ? 0.075 'SIDE CHAIN' 3 1 GLU A 83 ? ? 0.074 'SIDE CHAIN' 4 1 GLU A 85 ? ? 0.074 'SIDE CHAIN' 5 1 HIS A 93 ? ? 0.076 'SIDE CHAIN' 6 1 GLU A 105 ? ? 0.095 'SIDE CHAIN' 7 1 HIS A 113 ? ? 0.080 'SIDE CHAIN' 8 1 ARG A 118 ? ? 0.083 'SIDE CHAIN' 9 1 ASP A 126 ? ? 0.087 'SIDE CHAIN' 10 1 ASP A 141 ? ? 0.079 'SIDE CHAIN' 11 1 TYR A 146 ? ? 0.088 'SIDE CHAIN' 12 1 GLU A 148 ? ? 0.087 'SIDE CHAIN' # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 'PROTOPORPHYRIN IX CONTAINING FE' HEM 4 water HOH #