data_2MLT # _entry.id 2MLT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2MLT WWPDB D_1000178373 # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 1990-10-15 _pdbx_database_PDB_obs_spr.pdb_id 2MLT _pdbx_database_PDB_obs_spr.replace_pdb_id 1MLT _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2MLT _pdbx_database_status.recvd_initial_deposition_date 1990-10-04 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site ? _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Eisenberg, D.' 1 'Gribskov, M.' 2 'Terwilliger, T.C.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI 1 'The Structure of Melittin. I. Structure Determination and Partial Refinement.' J.Biol.Chem. 257 6010 ? 1982 JBCHA3 US 0021-9258 0071 ? ? ? 2 'The Structure of Melittin. II. Interpretation of the Structure' J.Biol.Chem. 257 6016 ? 1982 JBCHA3 US 0021-9258 0071 ? ? ? 3 ;Melittin Forms Crystals which are Suitable for High Resolution X-Ray Structural Analysis and which Reveal a Molecular 2-Fold Axis of Symmetry ; J.Biol.Chem. 255 2578 ? 1980 JBCHA3 US 0021-9258 0071 ? ? ? primary ? 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Gribskov, M.' 1 primary 'Wesson, L.' 2 primary 'Eisenberg, D.' 3 1 'Terwilliger, T.C.' 4 1 'Eisenberg, D.' 5 2 'Terwilliger, T.C.' 6 2 'Eisenberg, D.' 7 3 'Anderson, D.' 8 3 'Terwilliger, T.C.' 9 3 'Wickner, W.' 10 3 'Eisenberg, D.' 11 # _cell.entry_id 2MLT _cell.length_a 60.832 _cell.length_b 38.293 _cell.length_c 42.211 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 16 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2MLT _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man MELITTIN 2850.495 2 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 3 water nat water 18.015 23 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'GIGAVLKVLTTGLPALISWIKRKRQQ(NH2)' _entity_poly.pdbx_seq_one_letter_code_can GIGAVLKVLTTGLPALISWIKRKRQQX _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ILE n 1 3 GLY n 1 4 ALA n 1 5 VAL n 1 6 LEU n 1 7 LYS n 1 8 VAL n 1 9 LEU n 1 10 THR n 1 11 THR n 1 12 GLY n 1 13 LEU n 1 14 PRO n 1 15 ALA n 1 16 LEU n 1 17 ILE n 1 18 SER n 1 19 TRP n 1 20 ILE n 1 21 LYS n 1 22 ARG n 1 23 LYS n 1 24 ARG n 1 25 GLN n 1 26 GLN n 1 27 NH2 n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'honey bee' _entity_src_gen.gene_src_genus Apis _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Apis mellifera' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7460 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MEL_APIME _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P01501 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code MKFLVNVALVFMVVYISYIYAAPEPEPAPEPEAEADAEADPEAGIGAVLKVLTTGLPALISWIKRKRQQG _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2MLT A 1 ? 26 ? P01501 44 ? 69 ? 1 26 2 1 2MLT B 1 ? 26 ? P01501 44 ? 69 ? 1 26 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2MLT _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.16 _exptl_crystal.density_percent_sol 42.93 _exptl_crystal.description ? # _diffrn.id 1 _diffrn.crystal_id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? # _refine.entry_id 2MLT _refine.ls_number_reflns_obs 137 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.0 _refine.ls_d_res_high 2.0 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.1980000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 402 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 23 _refine_hist.number_atoms_total 435 _refine_hist.d_res_high 2.0 _refine_hist.d_res_low 20.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function p_bond_d 0.026 0.020 ? ? 'X-RAY DIFFRACTION' ? p_angle_d 0.046 0.030 ? ? 'X-RAY DIFFRACTION' ? p_angle_deg ? ? ? ? 'X-RAY DIFFRACTION' ? p_planar_d 0.073 0.050 ? ? 'X-RAY DIFFRACTION' ? p_hb_or_metal_coord ? ? ? ? 'X-RAY DIFFRACTION' ? p_mcbond_it 2.079 1.500 ? ? 'X-RAY DIFFRACTION' ? p_mcangle_it 2.913 2.000 ? ? 'X-RAY DIFFRACTION' ? p_scbond_it 4.043 2.000 ? ? 'X-RAY DIFFRACTION' ? p_scangle_it 6.281 3.000 ? ? 'X-RAY DIFFRACTION' ? p_plane_restr 0.016 0.020 ? ? 'X-RAY DIFFRACTION' ? p_chiral_restr 0.244 0.150 ? ? 'X-RAY DIFFRACTION' ? p_singtor_nbd 0.189 0.500 ? ? 'X-RAY DIFFRACTION' ? p_multtor_nbd 0.209 0.500 ? ? 'X-RAY DIFFRACTION' ? p_xhyhbond_nbd 0.544 0.500 ? ? 'X-RAY DIFFRACTION' ? p_xyhbond_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_planar_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_staggered_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_orthonormal_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_transverse_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_special_tor ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct_ncs_oper.id 1 _struct_ncs_oper.code given _struct_ncs_oper.details ? _struct_ncs_oper.matrix[1][1] -0.996310 _struct_ncs_oper.matrix[1][2] -0.033870 _struct_ncs_oper.matrix[1][3] -0.078870 _struct_ncs_oper.matrix[2][1] 0.048050 _struct_ncs_oper.matrix[2][2] -0.981470 _struct_ncs_oper.matrix[2][3] -0.185470 _struct_ncs_oper.matrix[3][1] -0.071130 _struct_ncs_oper.matrix[3][2] -0.188580 _struct_ncs_oper.matrix[3][3] 0.979480 _struct_ncs_oper.vector[1] 71.25100 _struct_ncs_oper.vector[2] 2.71100 _struct_ncs_oper.vector[3] 2.05300 # _struct.entry_id 2MLT _struct.title MELITTIN _struct.pdbx_descriptor MELITTIN _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MLT _struct_keywords.pdbx_keywords 'TOXIN (HEMOLYTIC POLYPEPTIDE)' _struct_keywords.text 'TOXIN (HEMOLYTIC POLYPEPTIDE)' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA GLY A 1 ? THR A 11 ? GLY A 1 THR A 11 1 ? 11 HELX_P HELX_P2 BA PRO A 14 ? GLN A 26 ? PRO A 14 GLN A 26 1 ? 13 HELX_P HELX_P3 AB GLY B 1 ? THR B 11 ? GLY B 1 THR B 11 1 ? 11 HELX_P HELX_P4 BB PRO B 14 ? GLN B 26 ? PRO B 14 GLN B 26 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A GLN 26 C ? ? ? 1_555 A NH2 27 N ? ? A GLN 26 A NH2 27 1_555 ? ? ? ? ? ? ? 1.319 ? covale2 covale ? ? B GLN 26 C ? ? ? 1_555 B NH2 27 N ? ? B GLN 26 B NH2 27 1_555 ? ? ? ? ? ? ? 1.302 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 B 28' AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 B 29' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ILE A 2 ? ILE A 2 . ? 1_555 ? 2 AC1 4 GLY A 3 ? GLY A 3 . ? 1_555 ? 3 AC1 4 TRP A 19 ? TRP A 19 . ? 8_546 ? 4 AC1 4 ARG B 24 ? ARG B 24 . ? 1_555 ? 5 AC2 7 ARG A 24 ? ARG A 24 . ? 1_555 ? 6 AC2 7 ILE B 2 ? ILE B 2 . ? 1_555 ? 7 AC2 7 GLY B 3 ? GLY B 3 . ? 1_555 ? 8 AC2 7 TRP B 19 ? TRP B 19 . ? 8_456 ? 9 AC2 7 LYS B 23 ? LYS B 23 . ? 8_456 ? 10 AC2 7 ARG B 24 ? ARG B 24 . ? 5_455 ? 11 AC2 7 HOH F . ? HOH B 31 . ? 1_555 ? # _database_PDB_matrix.entry_id 2MLT _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2MLT _atom_sites.fract_transf_matrix[1][1] 0.016439 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026114 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023691 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 TRP 19 19 19 TRP TRP A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 NH2 27 27 27 NH2 NH2 A . n B 1 1 GLY 1 1 1 GLY GLY B . n B 1 2 ILE 2 2 2 ILE ILE B . n B 1 3 GLY 3 3 3 GLY GLY B . n B 1 4 ALA 4 4 4 ALA ALA B . n B 1 5 VAL 5 5 5 VAL VAL B . n B 1 6 LEU 6 6 6 LEU LEU B . n B 1 7 LYS 7 7 7 LYS LYS B . n B 1 8 VAL 8 8 8 VAL VAL B . n B 1 9 LEU 9 9 9 LEU LEU B . n B 1 10 THR 10 10 10 THR THR B . n B 1 11 THR 11 11 11 THR THR B . n B 1 12 GLY 12 12 12 GLY GLY B . n B 1 13 LEU 13 13 13 LEU LEU B . n B 1 14 PRO 14 14 14 PRO PRO B . n B 1 15 ALA 15 15 15 ALA ALA B . n B 1 16 LEU 16 16 16 LEU LEU B . n B 1 17 ILE 17 17 17 ILE ILE B . n B 1 18 SER 18 18 18 SER SER B . n B 1 19 TRP 19 19 19 TRP TRP B . n B 1 20 ILE 20 20 20 ILE ILE B . n B 1 21 LYS 21 21 21 LYS LYS B . n B 1 22 ARG 22 22 22 ARG ARG B . n B 1 23 LYS 23 23 23 LYS LYS B . n B 1 24 ARG 24 24 24 ARG ARG B . n B 1 25 GLN 25 25 25 GLN GLN B . n B 1 26 GLN 26 26 26 GLN GLN B . n B 1 27 NH2 27 27 27 NH2 NH2 B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 SO4 1 28 27 SO4 SO4 B . D 2 SO4 1 29 28 SO4 SO4 B . E 3 HOH 1 28 28 HOH HOH A . E 3 HOH 2 29 29 HOH HOH A . E 3 HOH 3 30 30 HOH HOH A . E 3 HOH 4 31 31 HOH HOH A . E 3 HOH 5 32 32 HOH HOH A . E 3 HOH 6 33 33 HOH HOH A . E 3 HOH 7 34 34 HOH HOH A . E 3 HOH 8 35 35 HOH HOH A . E 3 HOH 9 36 36 HOH HOH A . F 3 HOH 1 30 30 HOH HOH B . F 3 HOH 2 31 31 HOH HOH B . F 3 HOH 3 32 32 HOH HOH B . F 3 HOH 4 33 33 HOH HOH B . F 3 HOH 5 34 34 HOH HOH B . F 3 HOH 6 35 35 HOH HOH B . F 3 HOH 7 36 36 HOH HOH B . F 3 HOH 8 37 37 HOH HOH B . F 3 HOH 9 38 38 HOH HOH B . F 3 HOH 10 39 39 HOH HOH B . F 3 HOH 11 40 40 HOH HOH B . F 3 HOH 12 41 41 HOH HOH B . F 3 HOH 13 42 42 HOH HOH B . F 3 HOH 14 43 43 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5220 ? 1 MORE -84 ? 1 'SSA (A^2)' 6280 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_556 x,-y,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 42.2110000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 36 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id E _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1990-10-15 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2011-11-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Atomic model' # _software.name PROFFT _software.classification refinement _software.version . _software.citation_id ? _software.pdbx_ordinal 1 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A VAL 5 ? ? CB A VAL 5 ? ? CG2 A VAL 5 ? ? 120.08 110.90 9.18 1.50 N 2 1 CB A LEU 6 ? ? CA A LEU 6 ? ? C A LEU 6 ? ? 121.78 110.20 11.58 1.90 N 3 1 NE A ARG 22 ? ? CZ A ARG 22 ? ? NH1 A ARG 22 ? ? 125.61 120.30 5.31 0.50 N 4 1 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 117.22 120.30 -3.08 0.50 N 5 1 CA A GLN 26 ? ? C A GLN 26 ? ? O A GLN 26 ? ? 105.45 120.10 -14.65 2.10 N 6 1 CD B ARG 22 ? ? NE B ARG 22 ? ? CZ B ARG 22 ? ? 133.30 123.60 9.70 1.40 N 7 1 CB B GLN 25 ? ? CG B GLN 25 ? ? CD B GLN 25 ? ? 129.72 111.60 18.12 2.60 N 8 1 O B GLN 26 ? ? C B GLN 26 ? ? N B NH2 27 ? ? 133.33 122.70 10.63 1.60 Y # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id THR _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 11 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -130.92 _pdbx_validate_torsion.psi -41.83 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH #