data_2MP1 # _entry.id 2MP1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MP1 pdb_00002mp1 10.2210/pdb2mp1/pdb RCSB RCSB103879 ? ? BMRB 19960 ? ? WWPDB D_1000103879 ? ? # _pdbx_database_related.db_id 19960 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MP1 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2014-05-09 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Veldkamp, C.T.' 1 'Peterson, F.C.' 2 'Gabel-Eissens, S.J.' 3 'Gillitzer, M.L.' 4 # _citation.id primary _citation.title 'Solution Structure of CCL19 and Identification of Overlapping CCR7 and PSGL-1 Binding Sites.' _citation.journal_abbrev Biochemistry _citation.journal_volume 54 _citation.page_first 4163 _citation.page_last 4166 _citation.year 2015 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 26115234 _citation.pdbx_database_id_DOI 10.1021/acs.biochem.5b00560 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Veldkamp, C.T.' 1 ? primary 'Kiermaier, E.' 2 ? primary 'Gabel-Eissens, S.J.' 3 ? primary 'Gillitzer, M.L.' 4 ? primary 'Lippner, D.R.' 5 ? primary 'DiSilvio, F.A.' 6 ? primary 'Mueller, C.J.' 7 ? primary 'Wantuch, P.L.' 8 ? primary 'Chaffee, G.R.' 9 ? primary 'Famiglietti, M.W.' 10 ? primary 'Zgoba, D.M.' 11 ? primary 'Bailey, A.A.' 12 ? primary 'Bah, Y.' 13 ? primary 'Engebretson, S.J.' 14 ? primary 'Graupner, D.R.' 15 ? primary 'Lackner, E.R.' 16 ? primary 'LaRosa, V.D.' 17 ? primary 'Medeiros, T.' 18 ? primary 'Olson, M.L.' 19 ? primary 'Phillips, A.J.' 20 ? primary 'Pyles, H.' 21 ? primary 'Richard, A.M.' 22 ? primary 'Schoeller, S.J.' 23 ? primary 'Touzeau, B.' 24 ? primary 'Williams, L.G.' 25 ? primary 'Sixt, M.' 26 ? primary 'Peterson, F.C.' 27 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'C-C motif chemokine 19' _entity.formula_weight 8814.282 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment CCL19 _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Beta-chemokine exodus-3, CK beta-11, Epstein-Barr virus-induced molecule 1 ligand chemokine, EBI1 ligand chemokine, ELC, Macrophage inflammatory protein 3 beta, MIP-3-beta, Small-inducible cytokine A19 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS _entity_poly.pdbx_seq_one_letter_code_can GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 THR n 1 3 ASN n 1 4 ASP n 1 5 ALA n 1 6 GLU n 1 7 ASP n 1 8 CYS n 1 9 CYS n 1 10 LEU n 1 11 SER n 1 12 VAL n 1 13 THR n 1 14 GLN n 1 15 LYS n 1 16 PRO n 1 17 ILE n 1 18 PRO n 1 19 GLY n 1 20 TYR n 1 21 ILE n 1 22 VAL n 1 23 ARG n 1 24 ASN n 1 25 PHE n 1 26 HIS n 1 27 TYR n 1 28 LEU n 1 29 LEU n 1 30 ILE n 1 31 LYS n 1 32 ASP n 1 33 GLY n 1 34 CYS n 1 35 ARG n 1 36 VAL n 1 37 PRO n 1 38 ALA n 1 39 VAL n 1 40 VAL n 1 41 PHE n 1 42 THR n 1 43 THR n 1 44 LEU n 1 45 ARG n 1 46 GLY n 1 47 ARG n 1 48 GLN n 1 49 LEU n 1 50 CYS n 1 51 ALA n 1 52 PRO n 1 53 PRO n 1 54 ASP n 1 55 GLN n 1 56 PRO n 1 57 TRP n 1 58 VAL n 1 59 GLU n 1 60 ARG n 1 61 ILE n 1 62 ILE n 1 63 GLN n 1 64 ARG n 1 65 LEU n 1 66 GLN n 1 67 ARG n 1 68 THR n 1 69 SER n 1 70 ALA n 1 71 LYS n 1 72 MET n 1 73 LYS n 1 74 ARG n 1 75 ARG n 1 76 SER n 1 77 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CCL19, ELC, MIP3B, SCYA19' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pQE30-SMT3 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CCL19_HUMAN _struct_ref.pdbx_db_accession Q99731 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS _struct_ref.pdbx_align_begin 22 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MP1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 77 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q99731 _struct_ref_seq.db_align_beg 22 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 98 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 77 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 3 1 '3D_13C-separated_NOESY (AROMATIC)' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength '6 mM' _pdbx_nmr_exptl_sample_conditions.pH 5.6 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '.515 mM [U-100% 13C; U-100% 15N] Human Chemokine CCL19, 10 % [U-99% 2H] D2O, 25 mM [U-100% 2H] dueterated MES, 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker DRX' # _pdbx_nmr_refine.entry_id 2MP1 _pdbx_nmr_refine.method ;AUTOMATED METHODS WERE USED FOR BACKBONE CHEMICAL SHIFT ASSIGNMENT AND ITERATIVE NOE REFINEMENT. FINAL STRUCTURES WERE OBTAINED BY MOLECULAR DYNAMICS IN EXPLICIT SOLVENT, AUTOMATED METHODS WERE USED FOR BACKBONE CHEMICAL SHIFT ASSIGNMENT AND ITERATIVE NOE REFINEMENT. FINAL STRUCTURES WERE OBTAINED BY MOLECULAR DYNAMICS IN EXPLICIT SOLVENT ; _pdbx_nmr_refine.details ;CCL19 STRUCTURES ARE BASED ON A TOTAL OF 2481 NOE CONSTRAINTS ( 1559 INTRA, 398 SEQUENTIAL, 171 MEDIUM, 353 LONG RANGE) AND 85 PHI AND PSI DIHEDRAL ANGLE CONSTRAINTS., CCL19 STRUCTURES ARE BASED ON A TOTAL OF 2481 NOE CONSTRAINTS ( 1559 INTRA, 398 SEQUENTIAL, 171 MEDIUM, 353 LONG RANGE) AND 85 PHI AND PSI DIHEDRAL ANGLE CONSTRAINTS. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MP1 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MP1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal SCHWIETERS,C.D.,KUSZEWSKI,J.J.,TJANDRA,N.,CLORE,G.M. refinement Xplor-NIH 2.9.3 1 Bruker collection TopSpin 3.1 2 'Delagio,F. et al.' processing NMRPipe 2007 3 'Eccles, C., Guntert, P., Billeter, M., Wuthrich, K.' 'data analysis' XEASY 1.3 4 'C. Bartels' 'data analysis' GARANT 2.1 5 'Keller, R.' 'data analysis' CARA 1.8.4 6 'Guntert, P.' refinement CYANA 3.1 7 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MP1 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MP1 _struct.title 'Solution structure of the human chemokine CCL19' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MP1 _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'chemokines, chemokine receptors, CCL19, CCL21, CCR7, SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id GLN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 55 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ALA _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 70 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 55 _struct_conf.end_auth_comp_id ALA _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 70 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 8 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 8 A CYS 34 1_555 ? ? ? ? ? ? ? 2.041 ? ? disulf2 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 50 SG ? ? A CYS 9 A CYS 50 1_555 ? ? ? ? ? ? ? 2.001 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 22 ? LEU A 28 ? VAL A 22 LEU A 28 A 2 ALA A 38 ? THR A 43 ? ALA A 38 THR A 43 A 3 GLN A 48 ? ALA A 51 ? GLN A 48 ALA A 51 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 23 ? N ARG A 23 O THR A 42 ? O THR A 42 A 2 3 N PHE A 41 ? N PHE A 41 O LEU A 49 ? O LEU A 49 # _atom_sites.entry_id 2MP1 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O Q S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 HIS 26 26 26 HIS HIS A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 CYS 50 50 50 CYS CYS A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 TRP 57 57 57 TRP TRP A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 MET 72 72 72 MET MET A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 SER 77 77 77 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-06-10 2 'Structure model' 1 1 2015-09-16 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'Human Chemokine CCL19-1' .515 ? mM '[U-100% 13C; U-100% 15N]' 1 D2O-2 10 ? % '[U-99% 2H]' 1 'dueterated MES-3' 25 ? mM '[U-100% 2H]' 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2MP1 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 2481 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 1559 _pdbx_nmr_constraints.NOE_long_range_total_count 353 _pdbx_nmr_constraints.NOE_medium_range_total_count 171 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 398 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 3 ? ? 53.59 84.11 2 1 LEU A 10 ? ? -96.28 -64.02 3 1 PRO A 16 ? ? -46.98 -87.92 4 2 THR A 2 ? ? -148.80 -69.65 5 2 CYS A 34 ? ? -178.82 148.51 6 2 MET A 72 ? ? -37.24 103.05 7 2 ARG A 75 ? ? -142.04 -148.99 8 3 ASP A 4 ? ? 74.98 -158.25 9 3 GLU A 6 ? ? 50.86 77.61 10 3 PRO A 16 ? ? -52.99 -85.61 11 3 ARG A 75 ? ? 66.79 93.57 12 4 GLU A 6 ? ? 65.16 -67.50 13 4 ASP A 7 ? ? -136.33 -59.19 14 4 SER A 11 ? ? -174.38 142.57 15 4 PRO A 16 ? ? -44.99 -73.03 16 4 CYS A 34 ? ? -171.59 -176.08 17 5 ASP A 4 ? ? 43.34 -78.80 18 5 PRO A 16 ? ? -67.48 -164.09 19 5 ALA A 38 ? ? -170.65 146.26 20 5 LYS A 71 ? ? 53.05 -91.01 21 5 SER A 76 ? ? 61.09 75.98 22 6 THR A 2 ? ? -69.93 99.05 23 6 ASN A 3 ? ? 70.73 159.41 24 6 ASP A 4 ? ? 73.75 -46.35 25 6 ASP A 7 ? ? -117.04 70.36 26 6 CYS A 8 ? ? 178.14 -176.63 27 6 PRO A 16 ? ? -51.39 -80.11 28 6 CYS A 34 ? ? -173.10 140.85 29 6 LYS A 73 ? ? 62.80 -82.78 30 6 ARG A 74 ? ? -137.91 -49.05 31 7 THR A 2 ? ? 63.57 91.86 32 7 ASN A 3 ? ? -155.01 -49.45 33 7 PRO A 16 ? ? -49.39 -76.12 34 8 GLU A 6 ? ? 48.74 -8.69 35 8 LEU A 10 ? ? -92.00 -64.86 36 8 PRO A 16 ? ? -42.36 -73.44 37 8 ARG A 35 ? ? -72.80 29.25 38 8 MET A 72 ? ? 57.53 85.10 39 8 ARG A 74 ? ? 74.43 -61.16 40 9 GLU A 6 ? ? 58.16 -161.28 41 9 LYS A 15 ? ? -162.04 100.61 42 9 PRO A 16 ? ? -51.52 -82.59 43 9 LYS A 71 ? ? 65.64 -67.81 44 9 ARG A 74 ? ? 55.55 75.84 45 10 ASN A 3 ? ? 62.25 93.06 46 10 SER A 11 ? ? -177.19 -173.97 47 10 PRO A 16 ? ? -54.07 -86.24 48 10 MET A 72 ? ? -126.96 -167.26 49 10 ARG A 75 ? ? -149.88 21.95 50 10 SER A 76 ? ? 69.47 81.87 51 11 ASN A 3 ? ? 177.77 122.32 52 11 GLU A 6 ? ? 63.80 175.44 53 11 LYS A 15 ? ? -160.20 99.20 54 11 PRO A 16 ? ? -51.51 -81.65 55 11 MET A 72 ? ? -52.36 94.48 56 12 ASP A 4 ? ? 76.58 -24.10 57 12 PRO A 16 ? ? -47.01 -80.60 58 12 LYS A 73 ? ? -163.48 113.56 59 12 ARG A 75 ? ? -123.51 -66.50 60 13 ASP A 4 ? ? -174.37 101.61 61 13 GLU A 6 ? ? 71.79 134.46 62 13 LEU A 10 ? ? -98.41 -64.69 63 13 PRO A 16 ? ? -39.62 -73.22 64 13 CYS A 34 ? ? -118.01 -87.24 65 13 ARG A 35 ? ? -143.23 15.18 66 13 ARG A 74 ? ? -161.88 17.81 67 14 GLU A 6 ? ? 46.54 -159.42 68 14 PRO A 16 ? ? -47.94 -78.20 69 14 ARG A 75 ? ? 64.49 98.52 70 15 LEU A 10 ? ? -95.00 -68.05 71 15 PRO A 16 ? ? -47.38 -77.77 72 15 MET A 72 ? ? 179.38 165.60 73 16 ARG A 75 ? ? 64.45 93.50 74 17 THR A 2 ? ? 66.34 -71.82 75 17 PRO A 16 ? ? -43.64 -83.14 76 17 ALA A 38 ? ? -172.65 -179.78 77 17 ARG A 74 ? ? 73.41 100.89 78 18 PRO A 16 ? ? -39.44 -82.24 79 18 ARG A 74 ? ? -129.82 -51.26 80 18 SER A 76 ? ? -106.23 77.20 81 19 GLU A 6 ? ? 52.96 -174.15 82 19 SER A 11 ? ? -173.01 143.42 83 19 PRO A 16 ? ? -52.13 -82.16 84 19 CYS A 34 ? ? 178.84 -175.50 85 20 ASN A 3 ? ? 71.16 115.32 86 20 ASP A 4 ? ? -82.47 38.04 87 20 PRO A 16 ? ? -46.54 -81.82 88 20 ARG A 74 ? ? 72.02 131.35 89 20 SER A 76 ? ? -170.06 93.81 #