data_2MR8 # _entry.id 2MR8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MR8 pdb_00002mr8 10.2210/pdb2mr8/pdb RCSB RCSB103956 ? ? BMRB 25065 ? ? WWPDB D_1000103956 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 2mr7 PDB 'the same protein in the apo state' unspecified 25064 BMRB 'the same protein in the apo state' unspecified 25065 BMRB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MR8 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2014-07-02 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Haslinger, K.' 1 'Maximowitsch, E.' 2 'Redfield, C.' 3 'Cryle, M.J.' 4 # _citation.id primary _citation.title 'Structure of the terminal PCP domain of the non-ribosomal peptide synthetase in teicoplanin biosynthesis.' _citation.journal_abbrev Proteins _citation.journal_volume 83 _citation.page_first 711 _citation.page_last 721 _citation.year 2015 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25586301 _citation.pdbx_database_id_DOI 10.1002/prot.24758 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Haslinger, K.' 1 ? primary 'Redfield, C.' 2 ? primary 'Cryle, M.J.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Non-ribosomal peptide synthetase' _entity.formula_weight 9631.036 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GAMAKAPESATEKVLCALYAEILGVERVGVDDAFHDLGGSSALAMRLIARIREELGVDLPIRQLFSSPTPAGVARALAAK SASWSHPQFEK ; _entity_poly.pdbx_seq_one_letter_code_can ;GAMAKAPESATEKVLCALYAEILGVERVGVDDAFHDLGGSSALAMRLIARIREELGVDLPIRQLFSSPTPAGVARALAAK SASWSHPQFEK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 ALA n 1 5 LYS n 1 6 ALA n 1 7 PRO n 1 8 GLU n 1 9 SER n 1 10 ALA n 1 11 THR n 1 12 GLU n 1 13 LYS n 1 14 VAL n 1 15 LEU n 1 16 CYS n 1 17 ALA n 1 18 LEU n 1 19 TYR n 1 20 ALA n 1 21 GLU n 1 22 ILE n 1 23 LEU n 1 24 GLY n 1 25 VAL n 1 26 GLU n 1 27 ARG n 1 28 VAL n 1 29 GLY n 1 30 VAL n 1 31 ASP n 1 32 ASP n 1 33 ALA n 1 34 PHE n 1 35 HIS n 1 36 ASP n 1 37 LEU n 1 38 GLY n 1 39 GLY n 1 40 SER n 1 41 SER n 1 42 ALA n 1 43 LEU n 1 44 ALA n 1 45 MET n 1 46 ARG n 1 47 LEU n 1 48 ILE n 1 49 ALA n 1 50 ARG n 1 51 ILE n 1 52 ARG n 1 53 GLU n 1 54 GLU n 1 55 LEU n 1 56 GLY n 1 57 VAL n 1 58 ASP n 1 59 LEU n 1 60 PRO n 1 61 ILE n 1 62 ARG n 1 63 GLN n 1 64 LEU n 1 65 PHE n 1 66 SER n 1 67 SER n 1 68 PRO n 1 69 THR n 1 70 PRO n 1 71 ALA n 1 72 GLY n 1 73 VAL n 1 74 ALA n 1 75 ARG n 1 76 ALA n 1 77 LEU n 1 78 ALA n 1 79 ALA n 1 80 LYS n 1 81 SER n 1 82 ALA n 1 83 SER n 1 84 TRP n 1 85 SER n 1 86 HIS n 1 87 PRO n 1 88 GLN n 1 89 PHE n 1 90 GLU n 1 91 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene tcp12 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 1867 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Actinoplanes teichomyceticus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1867 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21gold (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pETGB1 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q70AZ6_ACTTI _struct_ref.pdbx_db_accession Q70AZ6 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code AKAPESATEKVLCALYAEILGVERVGVDDAFHDLGGSSALAMRLIARIREELGVDLPIRQLFSSPTPAGVARALAAKS _struct_ref.pdbx_align_begin 969 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MR8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 81 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q70AZ6 _struct_ref_seq.db_align_beg 969 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1046 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 81 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2MR8 GLY A 1 ? UNP Q70AZ6 ? ? 'expression tag' 1 1 1 2MR8 ALA A 2 ? UNP Q70AZ6 ? ? 'expression tag' 2 2 1 2MR8 MET A 3 ? UNP Q70AZ6 ? ? 'expression tag' 3 3 1 2MR8 ALA A 82 ? UNP Q70AZ6 ? ? 'expression tag' 82 4 1 2MR8 SER A 83 ? UNP Q70AZ6 ? ? 'expression tag' 83 5 1 2MR8 TRP A 84 ? UNP Q70AZ6 ? ? 'expression tag' 84 6 1 2MR8 SER A 85 ? UNP Q70AZ6 ? ? 'expression tag' 85 7 1 2MR8 HIS A 86 ? UNP Q70AZ6 ? ? 'expression tag' 86 8 1 2MR8 PRO A 87 ? UNP Q70AZ6 ? ? 'expression tag' 87 9 1 2MR8 GLN A 88 ? UNP Q70AZ6 ? ? 'expression tag' 88 10 1 2MR8 PHE A 89 ? UNP Q70AZ6 ? ? 'expression tag' 89 11 1 2MR8 GLU A 90 ? UNP Q70AZ6 ? ? 'expression tag' 90 12 1 2MR8 LYS A 91 ? UNP Q70AZ6 ? ? 'expression tag' 91 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 4 '3D 1H-15N NOESY' 1 2 3 '2D 1H-1H NOESY' 1 3 1 '3D 1H-13C NOESY' 1 4 2 '2D DQF-COSY' 1 5 4 '2D 1H-15N HSQC' 1 6 1 '2D 1H-13C HSQC' 1 7 1 '3D CBCA(CO)NH' 1 8 1 '3D HNCO' 1 9 1 '3D HNCA' 1 10 1 '3D HNCACB' 1 11 1 '3D HBHA(CO)NH' 1 12 1 '3D HN(CO)CA' 1 13 1 '3D HCCH-TOCSY' 1 14 1 '3D HNCCCONH' 1 15 1 '3D CBCANH' 1 16 2 '2D 1H-1H TOCSY' 1 17 4 '3D 1H-15N TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '350-500 uM [U-100% 13C; U-100% 15N] PCP7T, 50 mM TRIS, 95% H2O/5% D2O' 1 '95% H2O/5% D2O' '500 uM PCP7T, 50 mM TRIS, 95% H2O/5% D2O' 2 '95% H2O/5% D2O' '500 uM PCP7T, 50 mM TRIS, 100% D2O' 3 '100% D2O' '350-500 uM [U-100% 15N] PCP7T, 50 mM TRIS, 95% H2O/5% D2O' 4 '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Oxford OMEGA 1 'Oxford OMEGA' 750 Oxford OMEGA 2 'Oxford OMEGA' 950 Oxford OMEGA 3 'Oxford OMEGA' # _pdbx_nmr_refine.entry_id 2MR8 _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'all calculated structures submitted' _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MR8 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MR8 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal CCPN 'chemical shift assignment' 'CcpNmr Analysis' 2.2 1 CCPN 'peak picking' 'CcpNmr Analysis' 2.2 2 'YASARA Biosciences GmbH' processing YASARA 1.1 3 'YASARA Biosciences GmbH' refinement YASARA 1.1 4 'Cornilescu, Delaglio and Bax' processing YASARA 1.1 5 'Cornilescu, Delaglio and Bax' refinement YASARA 1.1 6 'YASARA Biosciences GmbH' processing YASARA 1.1 7 'YASARA Biosciences GmbH' refinement YASARA 1.1 8 'Cornilescu, Delaglio and Bax' processing YASARA 1.1 9 'Cornilescu, Delaglio and Bax' refinement YASARA 1.1 10 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'data analysis' NMRPipe ? 11 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 12 Vriend 'data analysis' 'WHAT IF' ? 13 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MR8 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MR8 _struct.title 'holo structure of the Peptidyl Carrier Protein Domain 7 of the teicoplanin producing Non-ribosomal peptide synthetase' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MR8 _struct_keywords.pdbx_keywords 'BIOSYNTHETIC PROTEIN' _struct_keywords.text 'Non-ribosomal peptide synthetase, peptidyl carrier protein, BIOSYNTHETIC PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 9 ? GLY A 24 ? SER A 9 GLY A 24 1 ? 16 HELX_P HELX_P2 2 SER A 40 ? GLY A 56 ? SER A 40 GLY A 56 1 ? 17 HELX_P HELX_P3 3 PRO A 60 ? SER A 67 ? PRO A 60 SER A 67 1 ? 8 HELX_P HELX_P4 4 THR A 69 ? ALA A 79 ? THR A 69 ALA A 79 1 ? 11 HELX_P HELX_P5 5 LYS A 80 ? ALA A 82 ? LYS A 80 ALA A 82 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2MR8 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 MET 45 45 45 MET MET A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 TRP 84 84 84 TRP TRP A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 LYS 91 91 91 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-01-28 2 'Structure model' 1 1 2015-04-08 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id PCP7T-1 ? 350-500 uM '[U-100% 13C; U-100% 15N]' 1 TRIS-2 50 ? mM ? 1 PCP7T-3 500 ? uM ? 2 TRIS-4 50 ? mM ? 2 PCP7T-5 500 ? uM ? 3 TRIS-6 50 ? mM ? 3 PCP7T-7 ? 350-500 uM '[U-100% 15N]' 4 TRIS-8 50 ? mM ? 4 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 15 _pdbx_validate_rmsd_bond.auth_atom_id_1 CB _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 SER _pdbx_validate_rmsd_bond.auth_seq_id_1 40 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 OG _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 SER _pdbx_validate_rmsd_bond.auth_seq_id_2 40 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.336 _pdbx_validate_rmsd_bond.bond_target_value 1.418 _pdbx_validate_rmsd_bond.bond_deviation -0.082 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.013 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 4 NE A ARG 52 ? ? CZ A ARG 52 ? ? NH1 A ARG 52 ? ? 123.81 120.30 3.51 0.50 N 2 6 NE A ARG 75 ? ? CZ A ARG 75 ? ? NH1 A ARG 75 ? ? 123.37 120.30 3.07 0.50 N 3 10 NE A ARG 50 ? ? CZ A ARG 50 ? ? NH1 A ARG 50 ? ? 123.34 120.30 3.04 0.50 N 4 11 NE A ARG 50 ? ? CZ A ARG 50 ? ? NH1 A ARG 50 ? ? 123.95 120.30 3.65 0.50 N 5 12 NE A ARG 50 ? ? CZ A ARG 50 ? ? NH1 A ARG 50 ? ? 124.00 120.30 3.70 0.50 N 6 15 NE A ARG 50 ? ? CZ A ARG 50 ? ? NH1 A ARG 50 ? ? 123.66 120.30 3.36 0.50 N 7 15 NE A ARG 50 ? ? CZ A ARG 50 ? ? NH2 A ARG 50 ? ? 117.23 120.30 -3.07 0.50 N 8 18 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 123.77 120.30 3.47 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 2 GLU A 8 ? ? -96.70 -60.22 2 4 ALA A 2 ? ? -147.89 -159.06 3 5 SER A 67 ? ? -154.06 68.75 4 6 ALA A 6 ? ? 66.01 165.06 5 6 SER A 67 ? ? -150.79 77.75 6 6 PRO A 87 ? ? -76.96 43.83 7 8 LYS A 5 ? ? -157.55 -95.00 8 8 ALA A 6 ? ? -165.75 -53.84 9 8 SER A 67 ? ? -156.10 73.55 10 11 ALA A 6 ? ? 65.91 156.80 11 11 GLU A 8 ? ? -92.55 41.57 12 12 GLU A 8 ? ? -97.18 -60.87 13 13 SER A 67 ? ? -154.43 69.59 14 14 SER A 67 ? ? -150.69 71.49 15 15 GLU A 8 ? ? -170.85 -10.77 16 17 LYS A 5 ? ? -116.13 -92.62 17 17 GLU A 8 ? ? -102.06 -65.05 18 19 MET A 3 ? ? 65.21 -29.58 19 20 ALA A 6 ? ? 62.82 148.17 #