data_2N17 # _entry.id 2N17 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104292 RCSB ? ? 2N17 PDB pdb_00002n17 10.2210/pdb2n17/pdb 18896 BMRB ? ? D_1000104292 WWPDB ? ? # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2015-05-06 _pdbx_database_PDB_obs_spr.pdb_id 2N17 _pdbx_database_PDB_obs_spr.replace_pdb_id 2M25 _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 18896 _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Chemical shift assignments' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2N17 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2015-03-23 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Negulescu, H.' 1 'Guo, Y.' 2 'Garner, T.P.' 3 'Goodwin, O.Y.' 4 'Henderson, G.' 5 'Laine, R.A.' 6 'Macnaughtan, M.A.' 7 # _citation.id primary _citation.title 'A Kazal-Type Serine Protease Inhibitor from the Defense Gland Secretion of the Subterranean Termite Coptotermes formosanus Shiraki.' _citation.journal_abbrev 'Plos One' _citation.journal_volume 10 _citation.page_first e0125376 _citation.page_last e0125376 _citation.year 2015 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1932-6203 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25978745 _citation.pdbx_database_id_DOI 10.1371/journal.pone.0125376 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Negulescu, H.' 1 ? primary 'Guo, Y.' 2 ? primary 'Garner, T.P.' 3 ? primary 'Goodwin, O.Y.' 4 ? primary 'Henderson, G.' 5 ? primary 'Laine, R.A.' 6 ? primary 'Macnaughtan, M.A.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Lysozyme-Protease Inhibitor Protein' _entity.formula_weight 8578.577 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MAHHHHHHVDDDDKPEDCQLFCPMIYAPICATDGVSQRTFSNPCDLKVYNCWNPDNPYKEVKVGECDDANKPVPI _entity_poly.pdbx_seq_one_letter_code_can MAHHHHHHVDDDDKPEDCQLFCPMIYAPICATDGVSQRTFSNPCDLKVYNCWNPDNPYKEVKVGECDDANKPVPI _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 VAL n 1 10 ASP n 1 11 ASP n 1 12 ASP n 1 13 ASP n 1 14 LYS n 1 15 PRO n 1 16 GLU n 1 17 ASP n 1 18 CYS n 1 19 GLN n 1 20 LEU n 1 21 PHE n 1 22 CYS n 1 23 PRO n 1 24 MET n 1 25 ILE n 1 26 TYR n 1 27 ALA n 1 28 PRO n 1 29 ILE n 1 30 CYS n 1 31 ALA n 1 32 THR n 1 33 ASP n 1 34 GLY n 1 35 VAL n 1 36 SER n 1 37 GLN n 1 38 ARG n 1 39 THR n 1 40 PHE n 1 41 SER n 1 42 ASN n 1 43 PRO n 1 44 CYS n 1 45 ASP n 1 46 LEU n 1 47 LYS n 1 48 VAL n 1 49 TYR n 1 50 ASN n 1 51 CYS n 1 52 TRP n 1 53 ASN n 1 54 PRO n 1 55 ASP n 1 56 ASN n 1 57 PRO n 1 58 TYR n 1 59 LYS n 1 60 GLU n 1 61 VAL n 1 62 LYS n 1 63 VAL n 1 64 GLY n 1 65 GLU n 1 66 CYS n 1 67 ASP n 1 68 ASP n 1 69 ALA n 1 70 ASN n 1 71 LYS n 1 72 PRO n 1 73 VAL n 1 74 PRO n 1 75 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Formosan subterranean termite' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Coptotermes formosanus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 36987 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET46 Ek/LIC' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code V9GZ93_COPFO _struct_ref.pdbx_db_accession V9GZ93 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MIYAPICATDGVSQRTFSNPCDLKVYNCWNPDNPYKEVKVGECDDANKPVPI _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2N17 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 24 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 75 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession V9GZ93 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 52 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 24 _struct_ref_seq.pdbx_auth_seq_align_end 75 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2N17 MET A 1 ? UNP V9GZ93 ? ? 'expression tag' 1 1 1 2N17 ALA A 2 ? UNP V9GZ93 ? ? 'expression tag' 2 2 1 2N17 HIS A 3 ? UNP V9GZ93 ? ? 'expression tag' 3 3 1 2N17 HIS A 4 ? UNP V9GZ93 ? ? 'expression tag' 4 4 1 2N17 HIS A 5 ? UNP V9GZ93 ? ? 'expression tag' 5 5 1 2N17 HIS A 6 ? UNP V9GZ93 ? ? 'expression tag' 6 6 1 2N17 HIS A 7 ? UNP V9GZ93 ? ? 'expression tag' 7 7 1 2N17 HIS A 8 ? UNP V9GZ93 ? ? 'expression tag' 8 8 1 2N17 VAL A 9 ? UNP V9GZ93 ? ? 'expression tag' 9 9 1 2N17 ASP A 10 ? UNP V9GZ93 ? ? 'expression tag' 10 10 1 2N17 ASP A 11 ? UNP V9GZ93 ? ? 'expression tag' 11 11 1 2N17 ASP A 12 ? UNP V9GZ93 ? ? 'expression tag' 12 12 1 2N17 ASP A 13 ? UNP V9GZ93 ? ? 'expression tag' 13 13 1 2N17 LYS A 14 ? UNP V9GZ93 ? ? 'expression tag' 14 14 1 2N17 PRO A 15 ? UNP V9GZ93 ? ? 'expression tag' 15 15 1 2N17 GLU A 16 ? UNP V9GZ93 ? ? 'expression tag' 16 16 1 2N17 ASP A 17 ? UNP V9GZ93 ? ? 'expression tag' 17 17 1 2N17 CYS A 18 ? UNP V9GZ93 ? ? 'expression tag' 18 18 1 2N17 GLN A 19 ? UNP V9GZ93 ? ? 'expression tag' 19 19 1 2N17 LEU A 20 ? UNP V9GZ93 ? ? 'expression tag' 20 20 1 2N17 PHE A 21 ? UNP V9GZ93 ? ? 'expression tag' 21 21 1 2N17 CYS A 22 ? UNP V9GZ93 ? ? 'expression tag' 22 22 1 2N17 PRO A 23 ? UNP V9GZ93 ? ? 'expression tag' 23 23 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '2D 1H-1H NOESY' 1 4 1 '2D 1H-1H TOCSY' 1 5 1 '2D 1H-1H COSY' 1 6 1 '3D 1H-15N NOESY' 1 7 1 '3D 1H-15N TOCSY' 1 8 1 '3D HNCACB' 1 9 1 '3D HN(COCA)CB' 1 10 1 '3D HNCO' 1 11 1 '3D HCACO' 1 12 1 '3D 1H-13C NOESY' 1 13 1 '3D HCCH-TOCSY' 1 14 1 '3D HNHB' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.12 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1 mM [U-99% 13C; U-99% 15N] TFP4, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model VS-700 _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian VS-700' # _pdbx_nmr_refine.entry_id 2N17 _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2N17 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2N17 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal Agilent collection VnmrJ ? 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 7.8 2 CCPN 'data analysis' CCPNMR 2.2.2 3 CCPN 'peak picking' CCPNMR 2.2.2 4 CCPN 'chemical shift assignment' CCPNMR 2.2.2 5 CCPN 'noe assignment' CCPNMR 2.2.2 6 CCPN 'dihedral angle' CCPNMR 2.2.2 7 'Brunger, Adams, Clore, Gros, Nilges and Read' 'geometry optimization' CNS 1.2 8 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.2 9 'Cornilescu, Delaglio and Bax' 'dihedral angle' TALOS ? 10 'Bhattacharya and Montelione' 'structure validation' PSVS 1.5 11 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2N17 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N17 _struct.title ;NMR structure of a Kazal-type serine protease inhibitor from the subterranean termite defense gland of Coptotermes formosanus Shiraki soldiers ; _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2N17 _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'Kazal-type, serine protease inhibitor, chymotrypsin, elastase, termite, soldier, defense gland, secretion, hydrolase' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 42 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 53 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 42 _struct_conf.end_auth_comp_id ASN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 53 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 18 SG ? ? ? 1_555 A CYS 51 SG ? ? A CYS 18 A CYS 51 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf2 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 44 SG ? ? A CYS 22 A CYS 44 1_555 ? ? ? ? ? ? ? 2.033 ? ? disulf3 disulf ? ? A CYS 30 SG ? ? ? 1_555 A CYS 66 SG ? ? A CYS 30 A CYS 66 1_555 ? ? ? ? ? ? ? 2.029 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 38 ? PHE A 40 ? ARG A 38 PHE A 40 A 2 ILE A 29 ? ALA A 31 ? ILE A 29 ALA A 31 A 3 GLU A 60 ? LYS A 62 ? GLU A 60 LYS A 62 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O PHE A 40 ? O PHE A 40 N ILE A 29 ? N ILE A 29 A 2 3 N CYS A 30 ? N CYS A 30 O LYS A 62 ? O LYS A 62 # _atom_sites.entry_id 2N17 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 HIS 3 3 ? ? ? A . n A 1 4 HIS 4 4 ? ? ? A . n A 1 5 HIS 5 5 ? ? ? A . n A 1 6 HIS 6 6 ? ? ? A . n A 1 7 HIS 7 7 ? ? ? A . n A 1 8 HIS 8 8 ? ? ? A . n A 1 9 VAL 9 9 ? ? ? A . n A 1 10 ASP 10 10 ? ? ? A . n A 1 11 ASP 11 11 ? ? ? A . n A 1 12 ASP 12 12 ? ? ? A . n A 1 13 ASP 13 13 ? ? ? A . n A 1 14 LYS 14 14 ? ? ? A . n A 1 15 PRO 15 15 ? ? ? A . n A 1 16 GLU 16 16 ? ? ? A . n A 1 17 ASP 17 17 ? ? ? A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 MET 24 24 24 MET MET A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 TRP 52 52 52 TRP TRP A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 PRO 74 74 ? ? ? A . n A 1 75 ILE 75 75 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-05-06 2 'Structure model' 1 1 2015-05-27 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_nmr_exptl_sample.component TFP4-1 _pdbx_nmr_exptl_sample.concentration 1 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-99% 13C; U-99% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2N17 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 526 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 191 _pdbx_nmr_constraints.NOE_long_range_total_count 100 _pdbx_nmr_constraints.NOE_medium_range_total_count 50 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 185 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A HIS 3 ? A HIS 3 4 1 Y 1 A HIS 4 ? A HIS 4 5 1 Y 1 A HIS 5 ? A HIS 5 6 1 Y 1 A HIS 6 ? A HIS 6 7 1 Y 1 A HIS 7 ? A HIS 7 8 1 Y 1 A HIS 8 ? A HIS 8 9 1 Y 1 A VAL 9 ? A VAL 9 10 1 Y 1 A ASP 10 ? A ASP 10 11 1 Y 1 A ASP 11 ? A ASP 11 12 1 Y 1 A ASP 12 ? A ASP 12 13 1 Y 1 A ASP 13 ? A ASP 13 14 1 Y 1 A LYS 14 ? A LYS 14 15 1 Y 1 A PRO 15 ? A PRO 15 16 1 Y 1 A GLU 16 ? A GLU 16 17 1 Y 1 A ASP 17 ? A ASP 17 18 1 Y 1 A PRO 74 ? A PRO 74 19 1 Y 1 A ILE 75 ? A ILE 75 20 2 Y 1 A MET 1 ? A MET 1 21 2 Y 1 A ALA 2 ? A ALA 2 22 2 Y 1 A HIS 3 ? A HIS 3 23 2 Y 1 A HIS 4 ? A HIS 4 24 2 Y 1 A HIS 5 ? A HIS 5 25 2 Y 1 A HIS 6 ? A HIS 6 26 2 Y 1 A HIS 7 ? A HIS 7 27 2 Y 1 A HIS 8 ? A HIS 8 28 2 Y 1 A VAL 9 ? A VAL 9 29 2 Y 1 A ASP 10 ? A ASP 10 30 2 Y 1 A ASP 11 ? A ASP 11 31 2 Y 1 A ASP 12 ? A ASP 12 32 2 Y 1 A ASP 13 ? A ASP 13 33 2 Y 1 A LYS 14 ? A LYS 14 34 2 Y 1 A PRO 15 ? A PRO 15 35 2 Y 1 A GLU 16 ? A GLU 16 36 2 Y 1 A ASP 17 ? A ASP 17 37 2 Y 1 A PRO 74 ? A PRO 74 38 2 Y 1 A ILE 75 ? A ILE 75 39 3 Y 1 A MET 1 ? A MET 1 40 3 Y 1 A ALA 2 ? A ALA 2 41 3 Y 1 A HIS 3 ? A HIS 3 42 3 Y 1 A HIS 4 ? A HIS 4 43 3 Y 1 A HIS 5 ? A HIS 5 44 3 Y 1 A HIS 6 ? A HIS 6 45 3 Y 1 A HIS 7 ? A HIS 7 46 3 Y 1 A HIS 8 ? A HIS 8 47 3 Y 1 A VAL 9 ? A VAL 9 48 3 Y 1 A ASP 10 ? A ASP 10 49 3 Y 1 A ASP 11 ? A ASP 11 50 3 Y 1 A ASP 12 ? A ASP 12 51 3 Y 1 A ASP 13 ? A ASP 13 52 3 Y 1 A LYS 14 ? A LYS 14 53 3 Y 1 A PRO 15 ? A PRO 15 54 3 Y 1 A GLU 16 ? A GLU 16 55 3 Y 1 A ASP 17 ? A ASP 17 56 3 Y 1 A PRO 74 ? A PRO 74 57 3 Y 1 A ILE 75 ? A ILE 75 58 4 Y 1 A MET 1 ? A MET 1 59 4 Y 1 A ALA 2 ? A ALA 2 60 4 Y 1 A HIS 3 ? A HIS 3 61 4 Y 1 A HIS 4 ? A HIS 4 62 4 Y 1 A HIS 5 ? A HIS 5 63 4 Y 1 A HIS 6 ? A HIS 6 64 4 Y 1 A HIS 7 ? A HIS 7 65 4 Y 1 A HIS 8 ? A HIS 8 66 4 Y 1 A VAL 9 ? A VAL 9 67 4 Y 1 A ASP 10 ? A ASP 10 68 4 Y 1 A ASP 11 ? A ASP 11 69 4 Y 1 A ASP 12 ? A ASP 12 70 4 Y 1 A ASP 13 ? A ASP 13 71 4 Y 1 A LYS 14 ? A LYS 14 72 4 Y 1 A PRO 15 ? A PRO 15 73 4 Y 1 A GLU 16 ? A GLU 16 74 4 Y 1 A ASP 17 ? A ASP 17 75 4 Y 1 A PRO 74 ? A PRO 74 76 4 Y 1 A ILE 75 ? A ILE 75 77 5 Y 1 A MET 1 ? A MET 1 78 5 Y 1 A ALA 2 ? A ALA 2 79 5 Y 1 A HIS 3 ? A HIS 3 80 5 Y 1 A HIS 4 ? A HIS 4 81 5 Y 1 A HIS 5 ? A HIS 5 82 5 Y 1 A HIS 6 ? A HIS 6 83 5 Y 1 A HIS 7 ? A HIS 7 84 5 Y 1 A HIS 8 ? A HIS 8 85 5 Y 1 A VAL 9 ? A VAL 9 86 5 Y 1 A ASP 10 ? A ASP 10 87 5 Y 1 A ASP 11 ? A ASP 11 88 5 Y 1 A ASP 12 ? A ASP 12 89 5 Y 1 A ASP 13 ? A ASP 13 90 5 Y 1 A LYS 14 ? A LYS 14 91 5 Y 1 A PRO 15 ? A PRO 15 92 5 Y 1 A GLU 16 ? A GLU 16 93 5 Y 1 A ASP 17 ? A ASP 17 94 5 Y 1 A PRO 74 ? A PRO 74 95 5 Y 1 A ILE 75 ? A ILE 75 96 6 Y 1 A MET 1 ? A MET 1 97 6 Y 1 A ALA 2 ? A ALA 2 98 6 Y 1 A HIS 3 ? A HIS 3 99 6 Y 1 A HIS 4 ? A HIS 4 100 6 Y 1 A HIS 5 ? A HIS 5 101 6 Y 1 A HIS 6 ? A HIS 6 102 6 Y 1 A HIS 7 ? A HIS 7 103 6 Y 1 A HIS 8 ? A HIS 8 104 6 Y 1 A VAL 9 ? A VAL 9 105 6 Y 1 A ASP 10 ? A ASP 10 106 6 Y 1 A ASP 11 ? A ASP 11 107 6 Y 1 A ASP 12 ? A ASP 12 108 6 Y 1 A ASP 13 ? A ASP 13 109 6 Y 1 A LYS 14 ? A LYS 14 110 6 Y 1 A PRO 15 ? A PRO 15 111 6 Y 1 A GLU 16 ? A GLU 16 112 6 Y 1 A ASP 17 ? A ASP 17 113 6 Y 1 A PRO 74 ? A PRO 74 114 6 Y 1 A ILE 75 ? A ILE 75 115 7 Y 1 A MET 1 ? A MET 1 116 7 Y 1 A ALA 2 ? A ALA 2 117 7 Y 1 A HIS 3 ? A HIS 3 118 7 Y 1 A HIS 4 ? A HIS 4 119 7 Y 1 A HIS 5 ? A HIS 5 120 7 Y 1 A HIS 6 ? A HIS 6 121 7 Y 1 A HIS 7 ? A HIS 7 122 7 Y 1 A HIS 8 ? A HIS 8 123 7 Y 1 A VAL 9 ? A VAL 9 124 7 Y 1 A ASP 10 ? A ASP 10 125 7 Y 1 A ASP 11 ? A ASP 11 126 7 Y 1 A ASP 12 ? A ASP 12 127 7 Y 1 A ASP 13 ? A ASP 13 128 7 Y 1 A LYS 14 ? A LYS 14 129 7 Y 1 A PRO 15 ? A PRO 15 130 7 Y 1 A GLU 16 ? A GLU 16 131 7 Y 1 A ASP 17 ? A ASP 17 132 7 Y 1 A PRO 74 ? A PRO 74 133 7 Y 1 A ILE 75 ? A ILE 75 134 8 Y 1 A MET 1 ? A MET 1 135 8 Y 1 A ALA 2 ? A ALA 2 136 8 Y 1 A HIS 3 ? A HIS 3 137 8 Y 1 A HIS 4 ? A HIS 4 138 8 Y 1 A HIS 5 ? A HIS 5 139 8 Y 1 A HIS 6 ? A HIS 6 140 8 Y 1 A HIS 7 ? A HIS 7 141 8 Y 1 A HIS 8 ? A HIS 8 142 8 Y 1 A VAL 9 ? A VAL 9 143 8 Y 1 A ASP 10 ? A ASP 10 144 8 Y 1 A ASP 11 ? A ASP 11 145 8 Y 1 A ASP 12 ? A ASP 12 146 8 Y 1 A ASP 13 ? A ASP 13 147 8 Y 1 A LYS 14 ? A LYS 14 148 8 Y 1 A PRO 15 ? A PRO 15 149 8 Y 1 A GLU 16 ? A GLU 16 150 8 Y 1 A ASP 17 ? A ASP 17 151 8 Y 1 A PRO 74 ? A PRO 74 152 8 Y 1 A ILE 75 ? A ILE 75 153 9 Y 1 A MET 1 ? A MET 1 154 9 Y 1 A ALA 2 ? A ALA 2 155 9 Y 1 A HIS 3 ? A HIS 3 156 9 Y 1 A HIS 4 ? A HIS 4 157 9 Y 1 A HIS 5 ? A HIS 5 158 9 Y 1 A HIS 6 ? A HIS 6 159 9 Y 1 A HIS 7 ? A HIS 7 160 9 Y 1 A HIS 8 ? A HIS 8 161 9 Y 1 A VAL 9 ? A VAL 9 162 9 Y 1 A ASP 10 ? A ASP 10 163 9 Y 1 A ASP 11 ? A ASP 11 164 9 Y 1 A ASP 12 ? A ASP 12 165 9 Y 1 A ASP 13 ? A ASP 13 166 9 Y 1 A LYS 14 ? A LYS 14 167 9 Y 1 A PRO 15 ? A PRO 15 168 9 Y 1 A GLU 16 ? A GLU 16 169 9 Y 1 A ASP 17 ? A ASP 17 170 9 Y 1 A PRO 74 ? A PRO 74 171 9 Y 1 A ILE 75 ? A ILE 75 172 10 Y 1 A MET 1 ? A MET 1 173 10 Y 1 A ALA 2 ? A ALA 2 174 10 Y 1 A HIS 3 ? A HIS 3 175 10 Y 1 A HIS 4 ? A HIS 4 176 10 Y 1 A HIS 5 ? A HIS 5 177 10 Y 1 A HIS 6 ? A HIS 6 178 10 Y 1 A HIS 7 ? A HIS 7 179 10 Y 1 A HIS 8 ? A HIS 8 180 10 Y 1 A VAL 9 ? A VAL 9 181 10 Y 1 A ASP 10 ? A ASP 10 182 10 Y 1 A ASP 11 ? A ASP 11 183 10 Y 1 A ASP 12 ? A ASP 12 184 10 Y 1 A ASP 13 ? A ASP 13 185 10 Y 1 A LYS 14 ? A LYS 14 186 10 Y 1 A PRO 15 ? A PRO 15 187 10 Y 1 A GLU 16 ? A GLU 16 188 10 Y 1 A ASP 17 ? A ASP 17 189 10 Y 1 A PRO 74 ? A PRO 74 190 10 Y 1 A ILE 75 ? A ILE 75 #