data_2N2T # _entry.id 2N2T # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104350 RCSB ? ? 2N2T PDB pdb_00002n2t 10.2210/pdb2n2t/pdb 25611 BMRB ? ? D_1000104350 WWPDB ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 25611 BMRB unspecified . NESG-OR303 TargetTrack unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2N2T _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2015-05-14 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, G.' 1 'Lin, Y.' 2 'Koga, N.' 3 'Koga, R.' 4 'Xiao, R.' 5 'Janjua, H.' 6 'Hamilton, K.' 7 'Acton, T.B.' 8 'Kornhaber, G.' 9 'Everett, J.K.' 10 'Baker, D.' 11 'Montelione, G.T.' 12 'Northeast Structural Genomics Consortium (NESG)' 13 # _citation.id primary _citation.title 'Solution NMR Structure of DE NOVO DESIGNED PROTEIN (FDA_60), Northeast Structural Genomics Consortium (NESG) Target OR303' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, G.' 1 ? primary 'Lin, Y.' 2 ? primary 'Koga, N.' 3 ? primary 'Koga, R.' 4 ? primary 'Xiao, R.' 5 ? primary 'Janjua, H.' 6 ? primary 'Hamilton, K.' 7 ? primary 'Acton, T.B.' 8 ? primary 'Kornhaber, G.' 9 ? primary 'Everett, J.K.' 10 ? primary 'Baker, D.' 11 ? primary 'Montelione, G.T.' 12 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description OR303 _entity.formula_weight 10337.424 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGQWQIKIYSENEREFRELIERLEEERPSVQYTETTRNGRRQLTIRSNDKNEVDRILEEVRRKVPNARVRETETGSLEHH HHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGQWQIKIYSENEREFRELIERLEEERPSVQYTETTRNGRRQLTIRSNDKNEVDRILEEVRRKVPNARVRETETGSLEHH HHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NESG-OR303 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 GLN n 1 4 TRP n 1 5 GLN n 1 6 ILE n 1 7 LYS n 1 8 ILE n 1 9 TYR n 1 10 SER n 1 11 GLU n 1 12 ASN n 1 13 GLU n 1 14 ARG n 1 15 GLU n 1 16 PHE n 1 17 ARG n 1 18 GLU n 1 19 LEU n 1 20 ILE n 1 21 GLU n 1 22 ARG n 1 23 LEU n 1 24 GLU n 1 25 GLU n 1 26 GLU n 1 27 ARG n 1 28 PRO n 1 29 SER n 1 30 VAL n 1 31 GLN n 1 32 TYR n 1 33 THR n 1 34 GLU n 1 35 THR n 1 36 THR n 1 37 ARG n 1 38 ASN n 1 39 GLY n 1 40 ARG n 1 41 ARG n 1 42 GLN n 1 43 LEU n 1 44 THR n 1 45 ILE n 1 46 ARG n 1 47 SER n 1 48 ASN n 1 49 ASP n 1 50 LYS n 1 51 ASN n 1 52 GLU n 1 53 VAL n 1 54 ASP n 1 55 ARG n 1 56 ILE n 1 57 LEU n 1 58 GLU n 1 59 GLU n 1 60 VAL n 1 61 ARG n 1 62 ARG n 1 63 LYS n 1 64 VAL n 1 65 PRO n 1 66 ASN n 1 67 ALA n 1 68 ARG n 1 69 VAL n 1 70 ARG n 1 71 GLU n 1 72 THR n 1 73 GLU n 1 74 THR n 1 75 GLY n 1 76 SER n 1 77 LEU n 1 78 GLU n 1 79 HIS n 1 80 HIS n 1 81 HIS n 1 82 HIS n 1 83 HIS n 1 84 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pMgK' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET21_NESG _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 2N2T _struct_ref.pdbx_db_accession 2N2T _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2N2T _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 84 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 2N2T _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 84 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 84 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '3D 1H-13C arom NOESY' 1 7 1 '3D simutaneous 13C-aromatic,13C-aliphatic,15N edited 1H-1H NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.87 mM [U-100% 13C; U-100% 15N] OR303.005, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Varian INOVA 2 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2N2T _pdbx_nmr_refine.method 'distance geometry, simulated annealing, molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2N2T _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2N2T _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 1 'Guntert, Mumenthaler and Wuthrich' 'geometry optimization' CYANA 3.0 2 'Huang, Tejero, Powers and Montelione' refinement AutoStructure 2.1 3 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.1 4 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 5 'Bartels et al.' 'peak picking' XEASY ? 6 'Bruker Biospin' collection TopSpin ? 7 Varian collection VnmrJ ? 8 Goddard 'data analysis' Sparky ? 9 'Shen, Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS+ ? 10 'Bhattacharya, Montelione' 'data analysis' PSVS ? 11 'Guntert, Mumenthaler and Wuthrich' refinement CYANA ? 12 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 13 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2N2T _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N2T _struct.title 'Solution NMR Structure of DE NOVO DESIGNED PROTEIN (FDA_60), Northeast Structural Genomics Consortium (NESG) Target OR303' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2N2T _struct_keywords.pdbx_keywords 'Unknown Function, Structural Genomics' _struct_keywords.text ;Structural Genomics, Protein NMR, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), Target OR303, PSI-Biology, Protein Structure Initiative, Unknown Function ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 12 ? GLU A 26 ? ASN A 12 GLU A 26 1 ? 15 HELX_P HELX_P2 2 ASP A 49 ? VAL A 64 ? ASP A 49 VAL A 64 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ARG 27 A . ? ARG 27 A PRO 28 A ? PRO 28 A 1 1.02 2 ARG 27 A . ? ARG 27 A PRO 28 A ? PRO 28 A 2 -1.34 3 ARG 27 A . ? ARG 27 A PRO 28 A ? PRO 28 A 3 3.18 4 ARG 27 A . ? ARG 27 A PRO 28 A ? PRO 28 A 4 0.39 5 ARG 27 A . ? ARG 27 A PRO 28 A ? PRO 28 A 5 -0.42 6 ARG 27 A . ? ARG 27 A PRO 28 A ? PRO 28 A 6 -3.34 7 ARG 27 A . ? ARG 27 A PRO 28 A ? PRO 28 A 7 -5.75 8 ARG 27 A . ? ARG 27 A PRO 28 A ? PRO 28 A 8 5.68 9 ARG 27 A . ? ARG 27 A PRO 28 A ? PRO 28 A 9 4.26 10 ARG 27 A . ? ARG 27 A PRO 28 A ? PRO 28 A 10 -4.92 11 ARG 27 A . ? ARG 27 A PRO 28 A ? PRO 28 A 11 0.73 12 ARG 27 A . ? ARG 27 A PRO 28 A ? PRO 28 A 12 3.71 13 ARG 27 A . ? ARG 27 A PRO 28 A ? PRO 28 A 13 -1.30 14 ARG 27 A . ? ARG 27 A PRO 28 A ? PRO 28 A 14 -3.05 15 ARG 27 A . ? ARG 27 A PRO 28 A ? PRO 28 A 15 0.83 16 ARG 27 A . ? ARG 27 A PRO 28 A ? PRO 28 A 16 4.45 17 ARG 27 A . ? ARG 27 A PRO 28 A ? PRO 28 A 17 3.77 18 ARG 27 A . ? ARG 27 A PRO 28 A ? PRO 28 A 18 -11.70 19 ARG 27 A . ? ARG 27 A PRO 28 A ? PRO 28 A 19 -9.58 20 ARG 27 A . ? ARG 27 A PRO 28 A ? PRO 28 A 20 -1.30 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 31 ? ARG A 37 ? GLN A 31 ARG A 37 A 2 ARG A 40 ? SER A 47 ? ARG A 40 SER A 47 A 3 GLY A 2 ? TYR A 9 ? GLY A 2 TYR A 9 A 4 ARG A 68 ? GLY A 75 ? ARG A 68 GLY A 75 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N THR A 33 ? N THR A 33 O THR A 44 ? O THR A 44 A 2 3 O LEU A 43 ? O LEU A 43 N ILE A 8 ? N ILE A 8 A 3 4 N GLN A 5 ? N GLN A 5 O THR A 72 ? O THR A 72 # _atom_sites.entry_id 2N2T _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 TRP 4 4 4 TRP TRP A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 HIS 79 79 79 HIS HIS A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 HIS 83 83 83 HIS HIS A . n A 1 84 HIS 84 84 84 HIS HIS A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name PSI:Biology # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-09-16 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_nmr_exptl_sample.component OR303.005-1 _pdbx_nmr_exptl_sample.concentration 0.87 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-100% 13C; U-100% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 29 ? ? -172.80 140.97 2 1 LEU A 77 ? ? -142.96 23.61 3 1 HIS A 80 ? ? 47.23 90.97 4 2 GLU A 11 ? ? -100.06 59.50 5 2 SER A 29 ? ? -172.67 116.44 6 2 HIS A 83 ? ? -69.37 90.96 7 4 SER A 29 ? ? -171.83 127.76 8 5 HIS A 80 ? ? -55.15 82.72 9 6 HIS A 81 ? ? -69.70 93.80 10 7 SER A 29 ? ? 179.77 109.79 11 8 SER A 29 ? ? 175.07 140.51 12 8 ASN A 38 ? ? 70.37 33.51 13 8 SER A 76 ? ? -150.82 72.54 14 8 LEU A 77 ? ? -99.54 38.02 15 9 PRO A 28 ? ? -98.73 35.50 16 9 SER A 29 ? ? 75.49 124.31 17 9 PRO A 65 ? ? -68.36 5.81 18 10 SER A 76 ? ? -145.60 -48.02 19 11 HIS A 81 ? ? -67.59 92.26 20 11 HIS A 83 ? ? 179.11 153.14 21 12 ASN A 66 ? ? -102.14 72.33 22 12 HIS A 83 ? ? -76.80 31.18 23 13 SER A 29 ? ? -171.84 119.51 24 13 HIS A 79 ? ? -62.79 98.77 25 14 PRO A 28 ? ? -103.82 67.05 26 14 SER A 29 ? ? 71.01 90.29 27 14 SER A 76 ? ? -67.94 94.22 28 15 SER A 29 ? ? -172.27 143.76 29 15 HIS A 80 ? ? -63.43 97.18 30 16 SER A 29 ? ? -172.82 121.48 31 16 GLU A 78 ? ? -69.51 89.51 32 17 ASN A 12 ? ? -178.99 131.43 33 18 SER A 29 ? ? 172.10 95.04 34 18 ASN A 66 ? ? -99.11 31.23 35 18 HIS A 83 ? ? -96.08 48.70 36 19 SER A 29 ? ? -173.51 117.51 37 20 SER A 76 ? ? 176.02 -24.67 38 20 LEU A 77 ? ? -66.35 87.48 39 20 HIS A 83 ? ? -128.79 -78.10 #