data_2N49 # _entry.id 2N49 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104402 RCSB ? ? 2N49 PDB pdb_00002n49 10.2210/pdb2n49/pdb 15843 BMRB ? ? D_1000104402 WWPDB ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 2K5N PDB re-refinement unspecified 15843 BMRB 'BMRB Entry Tracking System' unspecified NESG-EwR156A TargetTrack . unspecified 2N42 PDB . unspecified 2N44 PDB . unspecified 2N45 PDB . unspecified 2N46 PDB . unspecified 2N47 PDB . unspecified 2N48 PDB . unspecified 2N4A PDB . unspecified 2N4B PDB . unspecified 2N4C PDB . unspecified 2N4D PDB . unspecified 2N4F PDB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2N49 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2015-06-17 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tang, Y.' 1 'Huang, Y.J.' 2 'Hopf, T.A.' 3 'Sander, C.' 4 'Marks, D.' 5 'Montelione, G.T.' 6 'Northeast Structural Genomics Consortium (NESG)' 7 # _citation.id primary _citation.title 'Protein structure determination by combining sparse NMR data with evolutionary couplings.' _citation.journal_abbrev Nat.Methods _citation.journal_volume 12 _citation.page_first 751 _citation.page_last 754 _citation.year 2015 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1548-7091 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 26121406 _citation.pdbx_database_id_DOI 10.1038/nmeth.3455 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tang, Y.' 1 ? primary 'Huang, Y.J.' 2 ? primary 'Hopf, T.A.' 3 ? primary 'Sander, C.' 4 ? primary 'Marks, D.S.' 5 ? primary 'Montelione, G.T.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Putative cold-shock protein' _entity.formula_weight 8417.549 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details '100% U-15N, 13C labeled sample' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MAMNGTITTWFKDKGFGFIKDENGDNRYFHVIKVANPDLIKKDAAVTFEPTTNNKGLSAYAVKVVPLEHHHHHH _entity_poly.pdbx_seq_one_letter_code_can MAMNGTITTWFKDKGFGFIKDENGDNRYFHVIKVANPDLIKKDAAVTFEPTTNNKGLSAYAVKVVPLEHHHHHH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NESG-EwR156A # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 MET n 1 4 ASN n 1 5 GLY n 1 6 THR n 1 7 ILE n 1 8 THR n 1 9 THR n 1 10 TRP n 1 11 PHE n 1 12 LYS n 1 13 ASP n 1 14 LYS n 1 15 GLY n 1 16 PHE n 1 17 GLY n 1 18 PHE n 1 19 ILE n 1 20 LYS n 1 21 ASP n 1 22 GLU n 1 23 ASN n 1 24 GLY n 1 25 ASP n 1 26 ASN n 1 27 ARG n 1 28 TYR n 1 29 PHE n 1 30 HIS n 1 31 VAL n 1 32 ILE n 1 33 LYS n 1 34 VAL n 1 35 ALA n 1 36 ASN n 1 37 PRO n 1 38 ASP n 1 39 LEU n 1 40 ILE n 1 41 LYS n 1 42 LYS n 1 43 ASP n 1 44 ALA n 1 45 ALA n 1 46 VAL n 1 47 THR n 1 48 PHE n 1 49 GLU n 1 50 PRO n 1 51 THR n 1 52 THR n 1 53 ASN n 1 54 ASN n 1 55 LYS n 1 56 GLY n 1 57 LEU n 1 58 SER n 1 59 ALA n 1 60 TYR n 1 61 ALA n 1 62 VAL n 1 63 LYS n 1 64 VAL n 1 65 VAL n 1 66 PRO n 1 67 LEU n 1 68 GLU n 1 69 HIS n 1 70 HIS n 1 71 HIS n 1 72 HIS n 1 73 HIS n 1 74 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ECA1580 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'SCRI 1043 / ATCC BAA-672' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pectobacterium atrosepticum SCRI1043' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 218491 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pGEX-6P _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q6D6V0_PECAS _struct_ref.pdbx_db_accession Q6D6V0 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MAMNGTITTWFKDKGFGFIKDENGDNRYFHVIKVANPDLIKKDAAVTFEPTTNNKGLSAYAVKVVP _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2N49 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 66 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6D6V0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 66 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 66 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2N49 LEU A 67 ? UNP Q6D6V0 ? ? 'expression tag' 67 1 1 2N49 GLU A 68 ? UNP Q6D6V0 ? ? 'expression tag' 68 2 1 2N49 HIS A 69 ? UNP Q6D6V0 ? ? 'expression tag' 69 3 1 2N49 HIS A 70 ? UNP Q6D6V0 ? ? 'expression tag' 70 4 1 2N49 HIS A 71 ? UNP Q6D6V0 ? ? 'expression tag' 71 5 1 2N49 HIS A 72 ? UNP Q6D6V0 ? ? 'expression tag' 72 6 1 2N49 HIS A 73 ? UNP Q6D6V0 ? ? 'expression tag' 73 7 1 2N49 HIS A 74 ? UNP Q6D6V0 ? ? 'expression tag' 74 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_refine.entry_id 2N49 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details 'Protons from the Rosetta models were removed and added back using Reduce.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.text 'Author used the experimental data from entry 2K5N.' _pdbx_nmr_details.entry_id 2N49 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2N49 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2N49 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement Rosetta ? 'Baker, D.' 1 'data analysis' EVfold-plm ? ? 2 'data analysis' ASDP ? ? 3 'data analysis' CYANA ? 'Guntert, P., Mumenthaler, C. and Wuthrich, K.' 4 'data analysis' EC-NMR ? ? 5 'data analysis' TALOS+ ? ? 6 refinement Reduce ? 'Richardson, J., Richardson, D.' 7 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2N49 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N49 _struct.title ;EC-NMR Structure of Erwinia carotovora ECA1580 N-terminal Domain Determined by Combining Evolutionary Couplings (EC) and Sparse NMR Data. Northeast Structural Genomics Consortium target EwR156A ; _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2N49 _struct_keywords.pdbx_keywords 'Structural Genomics, Unknown Function' _struct_keywords.text ;cold shock protein, GFT NMR, NESGC, EC-NMR, OB fold, protein structure, PSI, Structural Genomics, Unknown Function, Northeast Structural Genomics Consortium ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ILE _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 32 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id VAL _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 34 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ILE _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 32 _struct_conf.end_auth_comp_id VAL _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 34 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 MET A 3 ? GLY A 5 ? MET A 3 GLY A 5 A 2 VAL A 46 ? PHE A 48 ? VAL A 46 PHE A 48 A 3 LYS A 63 ? VAL A 64 ? LYS A 63 VAL A 64 B 1 ILE A 7 ? PHE A 11 ? ILE A 7 PHE A 11 B 2 PHE A 16 ? LYS A 20 ? PHE A 16 LYS A 20 B 3 ASN A 26 ? HIS A 30 ? ASN A 26 HIS A 30 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N MET A 3 ? N MET A 3 O PHE A 48 ? O PHE A 48 A 2 3 N THR A 47 ? N THR A 47 O LYS A 63 ? O LYS A 63 B 1 2 N THR A 9 ? N THR A 9 O PHE A 18 ? O PHE A 18 B 2 3 N ILE A 19 ? N ILE A 19 O ARG A 27 ? O ARG A 27 # _atom_sites.entry_id 2N49 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 TRP 10 10 10 TRP TRP A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 HIS 71 71 71 HIS HIS A . n A 1 72 HIS 72 72 72 HIS HIS A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 HIS 74 74 74 HIS HIS A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name PSI:Biology # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-07-01 2 'Structure model' 1 1 2015-07-22 3 'Structure model' 1 2 2015-08-12 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_remark.id 0 _pdbx_database_remark.text ;THIS ENTRY 2N49 REFLECTS AN ALTERNATIVE MODELING OF THE ORIGINAL STRUCTURAL DATA IN 2K5N DETERMINED BY AUTHORS: J.L.MILLS, A.ELETSKY, Q.ZHANG, D.LEE, M.JIANG, C.CICCOSANTI, R.XIAO, J.LUI, J.K.EVERETT, G.V.T.SWAPNA, T.B.ACTON, B.ROST, G.T.MONTELIONE, T.SZYPERSKI,NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG) ; # _pdbx_nmr_exptl_sample.component EwR156A-1 _pdbx_nmr_exptl_sample.concentration 1.07 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-100% 13C; U-100% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 9 HB3 A PHE 29 ? ? HB1 A ALA 59 ? ? 1.23 2 11 HB3 A PHE 29 ? ? HB1 A ALA 59 ? ? 1.27 3 13 HB3 A PHE 29 ? ? HB1 A ALA 59 ? ? 1.34 4 14 HB3 A PHE 29 ? ? HB1 A ALA 59 ? ? 1.18 5 15 HB3 A PHE 29 ? ? HB1 A ALA 59 ? ? 1.23 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 45 ? ? 174.85 126.83 2 1 ASN A 53 ? ? -40.08 156.12 3 2 ALA A 45 ? ? 173.95 125.80 4 2 ASN A 53 ? ? -40.26 150.17 5 3 ALA A 45 ? ? 174.41 126.01 6 3 ASN A 53 ? ? -37.87 153.46 7 4 ALA A 45 ? ? -171.35 125.95 8 5 ALA A 45 ? ? -176.44 138.06 9 6 LYS A 42 ? ? -64.85 -176.46 10 6 ALA A 45 ? ? -166.86 116.58 11 6 ASN A 54 ? ? 74.96 -154.21 12 7 ALA A 45 ? ? -167.89 119.09 13 7 ASN A 54 ? ? 70.97 -154.89 14 8 LYS A 42 ? ? -49.18 -74.52 15 8 VAL A 46 ? ? -106.98 -155.28 16 9 LYS A 42 ? ? -68.38 -82.52 17 10 LYS A 42 ? ? -60.04 -80.73 18 10 VAL A 46 ? ? -100.11 -140.11 19 11 LYS A 42 ? ? -67.45 -82.30 20 12 LYS A 42 ? ? -42.57 -73.49 21 12 THR A 47 ? ? -73.14 -166.60 22 14 LYS A 42 ? ? -69.51 -83.71 23 16 LYS A 42 ? ? -51.90 -72.75 24 16 VAL A 46 ? ? -106.43 -155.06 25 17 THR A 47 ? ? -100.24 -163.34 26 18 THR A 47 ? ? -101.54 -164.08 27 19 LYS A 42 ? ? -39.82 130.32 28 19 ASN A 54 ? ? 59.98 -120.04 29 20 LYS A 42 ? ? 173.72 109.83 30 20 LEU A 67 ? ? -101.38 40.60 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 12 _pdbx_validate_peptide_omega.auth_comp_id_1 THR _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 47 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 PHE _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 48 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -144.76 #