data_2N4E # _entry.id 2N4E # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id RCSB104407 RCSB 2N4E PDB 25666 BMRB D_1000104407 WWPDB # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 25666 BMRB unspecified . NESG-OR34 TargetTrack unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2N4E _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2015-06-17 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, G.' 1 'Chan, K.' 2 'Basanta, B.' 3 'Xiao, R.' 4 'Janjua, H.' 5 'Kogan, S.' 6 'Maglaqui, M.' 7 'Ciccosanti, C.' 8 'Acton, T.B.' 9 'Kornhaber, G.' 10 'Everett, J.K.' 11 'Baker, D.' 12 'Montelione, G.T.' 13 'Northeast Structural Genomics Consortium (NESG)' 14 # _citation.id primary _citation.title 'Solution NMR Structure of DE NOVO DESIGNED PROTEIN Top7NNSTYCC, Northeast Structural Genomics Consortium (NESG) Target OR34' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Liu, G.' 1 primary 'Chan, K.' 2 primary 'Basanta, B.' 3 primary 'Xiao, R.' 4 primary 'Janjua, H.' 5 primary 'Kogan, S.' 6 primary 'Maglaqui, M.' 7 primary 'Ciccosanti, C.' 8 primary 'Acton, T.B.' 9 primary 'Kornhaber, G.' 10 primary 'Everett, J.K.' 11 primary 'Baker, D.' 12 primary 'Montelione, G.T.' 13 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description OR34 _entity.formula_weight 12146.514 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHRSGDIQVQNNNTCNGKTFDYTYTVTTESELQKVLNELKDYIKKQGCKRSRTSITARTKKEAEKFAAILIKVYA ELGYNDINVTWDGDTVTVEGQLEGVD ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHRSGDIQVQNNNTCNGKTFDYTYTVTTESELQKVLNELKDYIKKQGCKRSRTSITARTKKEAEKFAAILIKVYA ELGYNDINVTWDGDTVTVEGQLEGVD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NESG-OR34 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 ARG n 1 9 SER n 1 10 GLY n 1 11 ASP n 1 12 ILE n 1 13 GLN n 1 14 VAL n 1 15 GLN n 1 16 ASN n 1 17 ASN n 1 18 ASN n 1 19 THR n 1 20 CYS n 1 21 ASN n 1 22 GLY n 1 23 LYS n 1 24 THR n 1 25 PHE n 1 26 ASP n 1 27 TYR n 1 28 THR n 1 29 TYR n 1 30 THR n 1 31 VAL n 1 32 THR n 1 33 THR n 1 34 GLU n 1 35 SER n 1 36 GLU n 1 37 LEU n 1 38 GLN n 1 39 LYS n 1 40 VAL n 1 41 LEU n 1 42 ASN n 1 43 GLU n 1 44 LEU n 1 45 LYS n 1 46 ASP n 1 47 TYR n 1 48 ILE n 1 49 LYS n 1 50 LYS n 1 51 GLN n 1 52 GLY n 1 53 CYS n 1 54 LYS n 1 55 ARG n 1 56 SER n 1 57 ARG n 1 58 THR n 1 59 SER n 1 60 ILE n 1 61 THR n 1 62 ALA n 1 63 ARG n 1 64 THR n 1 65 LYS n 1 66 LYS n 1 67 GLU n 1 68 ALA n 1 69 GLU n 1 70 LYS n 1 71 PHE n 1 72 ALA n 1 73 ALA n 1 74 ILE n 1 75 LEU n 1 76 ILE n 1 77 LYS n 1 78 VAL n 1 79 TYR n 1 80 ALA n 1 81 GLU n 1 82 LEU n 1 83 GLY n 1 84 TYR n 1 85 ASN n 1 86 ASP n 1 87 ILE n 1 88 ASN n 1 89 VAL n 1 90 THR n 1 91 TRP n 1 92 ASP n 1 93 GLY n 1 94 ASP n 1 95 THR n 1 96 VAL n 1 97 THR n 1 98 VAL n 1 99 GLU n 1 100 GLY n 1 101 GLN n 1 102 LEU n 1 103 GLU n 1 104 GLY n 1 105 VAL n 1 106 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name Synthetic _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pMgK' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET29b+ _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 2N4E _struct_ref.pdbx_db_accession 2N4E _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2N4E _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 106 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 2N4E _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 106 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 106 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '3D 1H-13C arom NOESY' 1 7 1 '3D simutaneous 13C-aromatic,13C-aliphatic,15N edited 1H-1H NOESY' 1 8 1 '3D CCH-TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.369 mM [U-100% 13C; U-100% 15N] or34.018, 5 mM DTT, 100 mM NaCl, 10 mM Tris-HCl pH 7.5, 0.02 % NaN3, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker Avance 1 'Bruker Avance' 600 Varian INOVA 2 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2N4E _pdbx_nmr_refine.method 'distance geometry, simulated annealing, molecular dynamics, null' _pdbx_nmr_refine.details 'null, null' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2N4E _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2N4E _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' 'refinemen,structure solution,geometry optimization' CNS ? 1 'Guntert, Mumenthaler and Wuthrich' 'refinement,geometry optimization,structure solution' CYANA 3.0 2 'Huang, Tejero, Powers and Montelione' 'data analysis,refinement' AutoStructure 2.1 3 'Zimmerman, Moseley, Kulikowski and Montelione' 'data analysis,chemical shift assignment' AutoAssign 2.1 4 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 5 'Bartels et al.' 'data analysis,peak picking,chemical shift assignment' XEASY ? 6 'Bruker Biospin' collection TOPSPIN ? 7 Varian collection VNMRJ ? 8 Goddard 'data analysis' SPARKY ? 9 'Shen, Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS+ ? 10 'Bhattacharya, Montelione' 'structure validation' PSVS ? 11 ? refinement CYANA ? 12 ? refinement CNS ? 13 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2N4E _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N4E _struct.title 'Solution NMR Structure of DE NOVO DESIGNED PROTEIN Top7NNSTYCC, Northeast Structural Genomics Consortium (NESG) Target OR34' _struct.pdbx_descriptor OR34 _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2N4E _struct_keywords.pdbx_keywords 'Structural Genomics, De Novo Protein' _struct_keywords.text ;Structural Genomics, Protein NMR, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), Target OR34, Top 7 fold, PSI-Biology, Protein Structure Initiative, De Novo Protein ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 33 ? GLN A 51 ? THR A 33 GLN A 51 1 ? 19 HELX_P HELX_P2 2 THR A 64 ? GLY A 83 ? THR A 64 GLY A 83 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 20 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 53 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 20 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 53 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.058 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 28 ? VAL A 31 ? THR A 28 VAL A 31 A 2 ILE A 12 ? ASN A 18 ? ILE A 12 ASN A 18 A 3 SER A 56 ? THR A 61 ? SER A 56 THR A 61 A 4 THR A 95 ? GLU A 99 ? THR A 95 GLU A 99 A 5 ASN A 88 ? TRP A 91 ? ASN A 88 TRP A 91 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O TYR A 29 ? O TYR A 29 N VAL A 14 ? N VAL A 14 A 2 3 N ASN A 17 ? N ASN A 17 O ARG A 57 ? O ARG A 57 A 3 4 N THR A 58 ? N THR A 58 O VAL A 98 ? O VAL A 98 A 4 5 O GLU A 99 ? O GLU A 99 N ASN A 88 ? N ASN A 88 # _atom_sites.entry_id 2N4E _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 HIS 2 2 2 HIS HIS A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 ASN 85 85 85 ASN ASN A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 TRP 91 91 91 TRP TRP A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 GLN 101 101 101 GLN GLN A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 ASP 106 106 106 ASP ASP A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name PSI:Biology # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2015-12-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id or34.018-1 0.369 ? mM '[U-100% 13C; U-100% 15N]' 1 DTT-2 5 ? mM ? 1 NaCl-3 100 ? mM ? 1 'Tris-HCl pH 7.5-4' 10 ? mM ? 1 NaN3-5 0.02 ? % ? 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 8 ? ? -176.51 -19.18 2 1 SER A 9 ? ? -77.79 -147.14 3 1 CYS A 20 ? ? 72.96 44.45 4 1 ASP A 26 ? ? -162.26 -48.66 5 1 GLU A 103 ? ? -67.78 95.97 6 2 HIS A 2 ? ? 61.22 69.99 7 2 CYS A 20 ? ? -173.45 70.35 8 2 ASN A 21 ? ? 73.61 -66.85 9 2 THR A 24 ? ? -151.15 -67.83 10 2 ASN A 85 ? ? -99.88 -73.31 11 2 ASP A 86 ? ? -178.19 124.52 12 3 HIS A 5 ? ? -63.78 95.96 13 3 CYS A 20 ? ? 162.42 136.96 14 3 LYS A 54 ? ? -98.08 -74.92 15 3 TYR A 84 ? ? 51.11 74.89 16 3 ASN A 85 ? ? -154.67 -69.13 17 4 CYS A 20 ? ? 179.91 170.38 18 4 ASP A 26 ? ? -59.73 -80.88 19 4 TYR A 27 ? ? 55.19 18.88 20 4 LYS A 54 ? ? -142.88 -71.08 21 5 ASN A 21 ? ? -62.83 98.48 22 5 ARG A 63 ? ? -94.95 -60.50 23 5 TYR A 84 ? ? 56.66 98.91 24 5 ASP A 86 ? ? 70.16 97.75 25 6 ASP A 26 ? ? -177.28 135.76 26 6 GLN A 51 ? ? -96.69 -71.00 27 6 LYS A 54 ? ? -120.46 -84.58 28 7 HIS A 6 ? ? -53.42 99.00 29 8 CYS A 20 ? ? 177.26 166.94 30 9 SER A 9 ? ? -66.79 97.22 31 9 GLN A 51 ? ? -101.04 -163.59 32 9 ASN A 85 ? ? -155.28 -75.99 33 10 HIS A 4 ? ? -67.92 91.70 34 10 TYR A 84 ? ? -171.37 -66.15 35 10 ASN A 85 ? ? -176.32 -39.54 36 11 HIS A 7 ? ? -147.34 -27.15 37 11 ASN A 21 ? ? -130.14 -71.37 38 11 TYR A 84 ? ? -97.48 -61.07 39 11 ASN A 85 ? ? -145.36 44.31 40 12 CYS A 20 ? ? -171.74 107.48 41 12 LYS A 23 ? ? -165.50 99.46 42 12 LYS A 54 ? ? -113.06 -70.81 43 12 ASP A 86 ? ? -161.15 95.63 44 13 HIS A 2 ? ? -69.57 97.08 45 13 HIS A 5 ? ? -147.14 -62.22 46 13 CYS A 20 ? ? -130.82 -78.32 47 13 LYS A 54 ? ? -145.88 -60.70 48 13 TYR A 84 ? ? -152.60 -71.36 49 13 ASN A 85 ? ? -155.44 19.11 50 13 ASP A 86 ? ? -85.40 36.08 51 13 ASP A 92 ? ? -100.93 68.65 52 14 HIS A 3 ? ? -67.15 87.22 53 14 LYS A 54 ? ? -105.05 -150.78 54 14 ARG A 63 ? ? -116.85 -77.30 55 15 HIS A 2 ? ? -148.83 -79.53 56 15 CYS A 20 ? ? 169.69 117.56 57 15 ASN A 21 ? ? 68.67 -76.73 58 15 PHE A 25 ? ? -72.09 -80.72 59 16 ASN A 21 ? ? -69.12 88.62 60 16 TYR A 84 ? ? 64.15 85.40 61 16 ASP A 86 ? ? -66.48 83.56 62 17 LYS A 54 ? ? -76.64 -70.53 63 18 HIS A 5 ? ? -65.21 97.68 64 18 ARG A 8 ? ? -137.86 -57.17 65 18 LYS A 23 ? ? 89.94 -3.79 66 18 TYR A 27 ? ? -117.92 63.74 67 18 VAL A 105 ? ? 63.74 92.33 68 19 ASP A 26 ? ? -127.69 -65.05 69 19 CYS A 53 ? ? -140.57 -13.24 70 19 LYS A 54 ? ? 55.55 70.43 71 20 HIS A 5 ? ? -145.04 -71.43 72 20 HIS A 6 ? ? -140.64 -80.53 73 20 HIS A 7 ? ? 173.09 -176.33 74 20 CYS A 20 ? ? 66.48 72.93 75 20 GLN A 51 ? ? -118.23 -150.56 76 20 LYS A 54 ? ? -130.65 -157.52 77 20 THR A 61 ? ? -58.06 105.89 #