data_2N5J # _entry.id 2N5J # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104448 RCSB ? ? 2N5J PDB pdb_00002n5j 10.2210/pdb2n5j/pdb 25718 BMRB ? ? D_1000104448 WWPDB ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 25718 BMRB unspecified . 2N5K PDB unspecified . 2N5L PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2N5J _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2015-07-18 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yokogawa, M.' 1 'Tsushima, T.' 2 'Noda, N.N.' 3 'Kumeta, H.' 4 'Adachi, W.' 5 'Enokizono, Y.' 6 'Yamashita, K.' 7 'Standley, D.M.' 8 'Takeuchi, O.' 9 'Akira, S.' 10 'Inagaki, F.' 11 # _citation.id primary _citation.title 'Structural basis for the regulation of enzymatic activity of Regnase-1 by domain-domain interactions' _citation.journal_abbrev 'Sci Rep' _citation.journal_volume 6 _citation.page_first 22324 _citation.page_last 22324 _citation.year 2016 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 2045-2322 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 26927947 _citation.pdbx_database_id_DOI 10.1038/srep22324 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yokogawa, M.' 1 ? primary 'Tsushima, T.' 2 ? primary 'Noda, N.N.' 3 ? primary 'Kumeta, H.' 4 ? primary 'Enokizono, Y.' 5 ? primary 'Yamashita, K.' 6 ? primary 'Standley, D.M.' 7 ? primary 'Takeuchi, O.' 8 ? primary 'Akira, S.' 9 ? primary 'Inagaki, F.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Ribonuclease ZC3H12A' _entity.formula_weight 5422.198 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.1.-.- _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 45-89' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GPHMTSELQMKVDFFRKLGYSSSEIHSVLQKLGVQADTNTVLGELVKHG _entity_poly.pdbx_seq_one_letter_code_can GPHMTSELQMKVDFFRKLGYSSSEIHSVLQKLGVQADTNTVLGELVKHG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 HIS n 1 4 MET n 1 5 THR n 1 6 SER n 1 7 GLU n 1 8 LEU n 1 9 GLN n 1 10 MET n 1 11 LYS n 1 12 VAL n 1 13 ASP n 1 14 PHE n 1 15 PHE n 1 16 ARG n 1 17 LYS n 1 18 LEU n 1 19 GLY n 1 20 TYR n 1 21 SER n 1 22 SER n 1 23 SER n 1 24 GLU n 1 25 ILE n 1 26 HIS n 1 27 SER n 1 28 VAL n 1 29 LEU n 1 30 GLN n 1 31 LYS n 1 32 LEU n 1 33 GLY n 1 34 VAL n 1 35 GLN n 1 36 ALA n 1 37 ASP n 1 38 THR n 1 39 ASN n 1 40 THR n 1 41 VAL n 1 42 LEU n 1 43 GLY n 1 44 GLU n 1 45 LEU n 1 46 VAL n 1 47 LYS n 1 48 HIS n 1 49 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Zc3h12a _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pGEX6p _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZC12A_MOUSE _struct_ref.pdbx_db_accession Q5D1E7 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code TSELQMKVDFFRKLGYSSSEIHSVLQKLGVQADTNTVLGELVKHG _struct_ref.pdbx_align_begin 45 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2N5J _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 49 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5D1E7 _struct_ref_seq.db_align_beg 45 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 89 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 45 _struct_ref_seq.pdbx_auth_seq_align_end 89 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2N5J GLY A 1 ? UNP Q5D1E7 ? ? 'expression tag' 41 1 1 2N5J PRO A 2 ? UNP Q5D1E7 ? ? 'expression tag' 42 2 1 2N5J HIS A 3 ? UNP Q5D1E7 ? ? 'expression tag' 43 3 1 2N5J MET A 4 ? UNP Q5D1E7 ? ? 'expression tag' 44 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D 1H-13C NOESY aliphatic' 1 3 1 '3D 1H-15N NOESY' 1 4 1 '3D HNCA' 1 5 1 '3D HN(CA)HA' 1 6 1 '3D HN(CO)CA' 1 7 1 '3D HNCO' 1 8 1 '3D C(CO)NH' 1 9 1 '3D CBCA(CO)NH' 1 10 1 '3D HNCACB' 1 11 1 '3D H(CCO)NH' 1 12 1 '2D 1H-13C HSQC aliphatic' 1 13 1 '2D 1H-13C HSQC aromatic' 1 14 1 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 170 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents ;1.1 mM [U-99% 13C; U-99% 15N] Reg1_NTD-1, 5 ug DSS-2, 10% v/v [U-2H] D2O-3, 20 mM HEPES-4, 150 mM sodium chloride-5, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Agilent INOVA 1 'Agilent INOVA' 600 Agilent INOVA 2 'Agilent INOVA' 600 Agilent INOVA 3 'Agilent INOVA' # _pdbx_nmr_refine.entry_id 2N5J _pdbx_nmr_refine.method 'distance geometry' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2N5J _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2N5J _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version Varian collection VNMR 1 6.1C 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 2 2008 'Masashi Yokochi' 'chemical shift assignment' Olivia 3 ? 'Masashi Yokochi' 'peak picking' Olivia 4 ? 'Masashi Yokochi' 'data analysis' Olivia 5 ? 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS 6 ? 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 7 2.1 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 8 2.1 'JC Hoch and AS Sterm' processing rnmrtk 9 v.3 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2N5J _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N5J _struct.title 'Regnase-1 N-terminal domain' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2N5J _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'Regnase, Regnase-1, Zc3h12a, HYDROLASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 6 ? GLY A 19 ? SER A 46 GLY A 59 1 ? 14 HELX_P HELX_P2 2 SER A 21 ? GLY A 33 ? SER A 61 GLY A 73 1 ? 13 HELX_P HELX_P3 3 ASP A 37 ? GLY A 49 ? ASP A 77 GLY A 89 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2N5J _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 41 41 GLY GLY A . n A 1 2 PRO 2 42 42 PRO PRO A . n A 1 3 HIS 3 43 43 HIS HIS A . n A 1 4 MET 4 44 44 MET MET A . n A 1 5 THR 5 45 45 THR THR A . n A 1 6 SER 6 46 46 SER SER A . n A 1 7 GLU 7 47 47 GLU GLU A . n A 1 8 LEU 8 48 48 LEU LEU A . n A 1 9 GLN 9 49 49 GLN GLN A . n A 1 10 MET 10 50 50 MET MET A . n A 1 11 LYS 11 51 51 LYS LYS A . n A 1 12 VAL 12 52 52 VAL VAL A . n A 1 13 ASP 13 53 53 ASP ASP A . n A 1 14 PHE 14 54 54 PHE PHE A . n A 1 15 PHE 15 55 55 PHE PHE A . n A 1 16 ARG 16 56 56 ARG ARG A . n A 1 17 LYS 17 57 57 LYS LYS A . n A 1 18 LEU 18 58 58 LEU LEU A . n A 1 19 GLY 19 59 59 GLY GLY A . n A 1 20 TYR 20 60 60 TYR TYR A . n A 1 21 SER 21 61 61 SER SER A . n A 1 22 SER 22 62 62 SER SER A . n A 1 23 SER 23 63 63 SER SER A . n A 1 24 GLU 24 64 64 GLU GLU A . n A 1 25 ILE 25 65 65 ILE ILE A . n A 1 26 HIS 26 66 66 HIS HIS A . n A 1 27 SER 27 67 67 SER SER A . n A 1 28 VAL 28 68 68 VAL VAL A . n A 1 29 LEU 29 69 69 LEU LEU A . n A 1 30 GLN 30 70 70 GLN GLN A . n A 1 31 LYS 31 71 71 LYS LYS A . n A 1 32 LEU 32 72 72 LEU LEU A . n A 1 33 GLY 33 73 73 GLY GLY A . n A 1 34 VAL 34 74 74 VAL VAL A . n A 1 35 GLN 35 75 75 GLN GLN A . n A 1 36 ALA 36 76 76 ALA ALA A . n A 1 37 ASP 37 77 77 ASP ASP A . n A 1 38 THR 38 78 78 THR THR A . n A 1 39 ASN 39 79 79 ASN ASN A . n A 1 40 THR 40 80 80 THR THR A . n A 1 41 VAL 41 81 81 VAL VAL A . n A 1 42 LEU 42 82 82 LEU LEU A . n A 1 43 GLY 43 83 83 GLY GLY A . n A 1 44 GLU 44 84 84 GLU GLU A . n A 1 45 LEU 45 85 85 LEU LEU A . n A 1 46 VAL 46 86 86 VAL VAL A . n A 1 47 LYS 47 87 87 LYS LYS A . n A 1 48 HIS 48 88 88 HIS HIS A . n A 1 49 GLY 49 89 89 GLY GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-03-16 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id Reg1_NTD-1 1.1 ? mM '[U-99% 13C; U-99% 15N]' 1 DSS-2 5 ? % ? 1 D2O-3 10 ? v/v '[U-2H]' 1 HEPES-4 20 ? mM ? 1 'sodium chloride-5' 150 ? mM ? 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 44 ? ? -62.90 96.84 2 1 PHE A 54 ? ? -63.46 -72.74 3 1 LYS A 87 ? ? -99.35 -61.46 4 2 PRO A 42 ? ? -69.77 -174.97 5 2 PHE A 54 ? ? -62.80 -72.85 6 3 SER A 46 ? ? -172.39 135.85 7 3 PHE A 54 ? ? -62.54 -72.90 8 3 HIS A 88 ? ? -107.53 57.63 9 4 PRO A 42 ? ? -69.80 94.17 10 4 PHE A 54 ? ? -64.35 -72.83 11 5 MET A 44 ? ? -68.87 -174.96 12 5 PHE A 54 ? ? -63.19 -71.36 13 5 HIS A 88 ? ? -109.75 61.55 14 6 PHE A 54 ? ? -63.10 -72.55 15 7 THR A 45 ? ? 62.42 72.76 16 7 PHE A 54 ? ? -62.54 -72.91 17 7 LYS A 87 ? ? -102.09 -62.33 18 8 HIS A 43 ? ? -100.03 45.51 19 8 PHE A 54 ? ? -62.96 -72.87 20 9 PHE A 54 ? ? -63.24 -72.84 21 9 HIS A 88 ? ? -113.32 54.27 22 10 HIS A 43 ? ? -98.81 51.32 23 10 PHE A 54 ? ? -62.17 -70.70 24 11 PHE A 54 ? ? -62.70 -72.87 25 12 PHE A 54 ? ? -65.07 -72.68 26 12 HIS A 88 ? ? -113.14 55.74 27 13 HIS A 43 ? ? -130.64 -63.60 28 13 PHE A 54 ? ? -62.25 -72.85 29 13 HIS A 88 ? ? -110.26 59.73 30 14 PRO A 42 ? ? -69.81 98.79 31 15 PRO A 42 ? ? -69.70 -176.88 32 15 PHE A 54 ? ? -62.89 -72.72 33 16 PRO A 42 ? ? -69.67 92.48 34 16 PHE A 54 ? ? -64.00 -72.77 35 17 PHE A 54 ? ? -62.27 -70.19 36 17 LYS A 87 ? ? -92.49 -60.68 37 18 HIS A 88 ? ? -108.32 58.84 38 19 THR A 45 ? ? 54.84 76.39 39 19 PHE A 54 ? ? -62.75 -72.90 40 20 ALA A 76 ? ? -52.32 171.00 #