data_2N6R # _entry.id 2N6R # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.366 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104492 RCSB ? ? 2N6R PDB pdb_00002n6r 10.2210/pdb2n6r/pdb 25778 BMRB ? ? D_1000104492 WWPDB ? ? # _pdbx_database_related.db_id 25778 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2N6R _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2015-08-28 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pineda, S.S.' 1 'Chin, Y.K.-Y.' 2 'King, G.F.' 3 # _citation.id primary _citation.title 'Structural venomics reveals evolution of a complex venom by duplication and diversification of an ancient peptide-encoding gene.' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 117 _citation.page_first 11399 _citation.page_last 11408 _citation.year 2020 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 1091-6490 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 32398368 _citation.pdbx_database_id_DOI 10.1073/pnas.1914536117 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pineda, S.S.' 1 0000-0002-9003-0101 primary 'Chin, Y.K.' 2 ? primary 'Undheim, E.A.B.' 3 0000-0002-8667-3999 primary 'Senff, S.' 4 ? primary 'Mobli, M.' 5 ? primary 'Dauly, C.' 6 ? primary 'Escoubas, P.' 7 ? primary 'Nicholson, G.M.' 8 0000-0002-4277-4296 primary 'Kaas, Q.' 9 0000-0001-9988-6152 primary 'Guo, S.' 10 ? primary 'Herzig, V.' 11 0000-0003-2514-3983 primary 'Mattick, J.S.' 12 0000-0002-7680-7527 primary 'King, G.F.' 13 0000-0002-2308-2200 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description U4-hexatoxin-Hi1a _entity.formula_weight 8821.939 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GTPSADQVRYNYTELPNGEYCYTPRRRCTSADQCCRPYDTTAAFHGCGRIWPKDKREKVDRCYICNNEKTLCTSVM _entity_poly.pdbx_seq_one_letter_code_can GTPSADQVRYNYTELPNGEYCYTPRRRCTSADQCCRPYDTTAAFHGCGRIWPKDKREKVDRCYICNNEKTLCTSVM _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 THR n 1 3 PRO n 1 4 SER n 1 5 ALA n 1 6 ASP n 1 7 GLN n 1 8 VAL n 1 9 ARG n 1 10 TYR n 1 11 ASN n 1 12 TYR n 1 13 THR n 1 14 GLU n 1 15 LEU n 1 16 PRO n 1 17 ASN n 1 18 GLY n 1 19 GLU n 1 20 TYR n 1 21 CYS n 1 22 TYR n 1 23 THR n 1 24 PRO n 1 25 ARG n 1 26 ARG n 1 27 ARG n 1 28 CYS n 1 29 THR n 1 30 SER n 1 31 ALA n 1 32 ASP n 1 33 GLN n 1 34 CYS n 1 35 CYS n 1 36 ARG n 1 37 PRO n 1 38 TYR n 1 39 ASP n 1 40 THR n 1 41 THR n 1 42 ALA n 1 43 ALA n 1 44 PHE n 1 45 HIS n 1 46 GLY n 1 47 CYS n 1 48 GLY n 1 49 ARG n 1 50 ILE n 1 51 TRP n 1 52 PRO n 1 53 LYS n 1 54 ASP n 1 55 LYS n 1 56 ARG n 1 57 GLU n 1 58 LYS n 1 59 VAL n 1 60 ASP n 1 61 ARG n 1 62 CYS n 1 63 TYR n 1 64 ILE n 1 65 CYS n 1 66 ASN n 1 67 ASN n 1 68 GLU n 1 69 LYS n 1 70 THR n 1 71 LEU n 1 72 CYS n 1 73 THR n 1 74 SER n 1 75 VAL n 1 76 MET n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Hadronyche infensa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 153481 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 2N6R _struct_ref.pdbx_db_accession 2N6R _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2N6R _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 76 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 2N6R _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 76 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 76 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCO' 1 5 1 '3D HNCACB' 1 6 1 '3D 1H-15N NOESY' 1 7 1 '3D 1H-13C NOESY aliphatic' 1 8 1 '3D 1H-13C NOESY aromatic' 1 9 1 '4D HCC(CO)NH-TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '300 uM [U-99% 13C; U-99% 15N] U4-hexatoxin-Hi1a, 10 uM DSS, 20 mM MES, 0.02 % sodium azide, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # _pdbx_nmr_spectrometer.field_strength 900 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model 'AVANCE II' _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance II+' # _pdbx_nmr_refine.entry_id 2N6R _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'Lowest energy and best stereochemical properties' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2N6R _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2N6R _pdbx_nmr_representative.selection_criteria l # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin ? 1 'Bruker Biospin' processing TopSpin ? 2 Goddard 'chemical shift assignment' Sparky ? 3 'Hoch JC' 'processing nus data' Rowland_NMR_Toolkit ? 4 'Cornilescu, Delaglio and Bax' 'dihedral angle prediction' TALOS talos+ 5 'Guntert, Mumenthaler and Wuthrich' 'structure calculation' CYANA ? 6 'Guntert, Mumenthaler and Wuthrich' refinement CYANA ? 7 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2N6R _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N6R _struct.title 'NMR structure of spider toxin U4-hexatoxin-Hi1a' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2N6R _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'Spider toxin, Inhibitor cystine knot, toxin' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 4 ? ARG A 9 ? SER A 4 ARG A 9 5 ? 6 HELX_P HELX_P2 2 TRP A 51 ? LYS A 58 ? TRP A 51 LYS A 58 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 21 SG ? ? ? 1_555 A CYS 35 SG ? ? A CYS 21 A CYS 35 1_555 ? ? ? ? ? ? ? 1.997 ? ? disulf2 disulf ? ? A CYS 28 SG ? ? ? 1_555 A CYS 47 SG ? ? A CYS 28 A CYS 47 1_555 ? ? ? ? ? ? ? 2.000 ? ? disulf3 disulf ? ? A CYS 34 SG ? ? ? 1_555 A CYS 62 SG ? ? A CYS 34 A CYS 62 1_555 ? ? ? ? ? ? ? 1.991 ? ? disulf4 disulf ? ? A CYS 65 SG ? ? ? 1_555 A CYS 72 SG ? ? A CYS 65 A CYS 72 1_555 ? ? ? ? ? ? ? 2.000 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 3 _struct_sheet_order.range_id_2 4 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 10 ? ASN A 11 ? TYR A 10 ASN A 11 A 2 ARG A 36 ? PRO A 37 ? ARG A 36 PRO A 37 A 3 ALA A 43 ? GLY A 48 ? ALA A 43 GLY A 48 A 4 ARG A 61 ? ASN A 66 ? ARG A 61 ASN A 66 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 3 _pdbx_struct_sheet_hbond.range_id_2 4 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id GLY _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 48 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id GLY _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 48 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ARG _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 61 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ARG _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 61 # _atom_sites.entry_id 2N6R _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 TRP 51 51 51 TRP TRP A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 CYS 62 62 62 CYS CYS A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 CYS 65 65 65 CYS CYS A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 CYS 72 72 72 CYS CYS A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 MET 76 76 76 MET MET A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-08-31 2 'Structure model' 1 1 2023-03-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_nmr_software 5 2 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 2 'Structure model' '_database_2.pdbx_DOI' 14 2 'Structure model' '_database_2.pdbx_database_accession' 15 2 'Structure model' '_pdbx_nmr_software.name' 16 2 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_database_remark.id _pdbx_database_remark.text 650 ;HELIX DETERMINATION METHOD: AUTHOR DETERMINED ; 700 ;SHEET DETERMINATION METHOD: AUTHOR DETERMINED ; # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id U4-hexatoxin-Hi1a-1 300 ? uM '[U-99% 13C; U-99% 15N]' 1 DSS-2 10 ? uM ? 1 MES-3 20 ? mM ? 1 'sodium azide-4' 0.02 ? % ? 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 20 ? ? -98.15 -68.71 2 2 TYR A 20 ? ? -96.36 -68.96 3 2 THR A 23 ? ? -49.47 161.61 4 3 ARG A 9 ? ? -68.80 -179.04 5 3 TYR A 20 ? ? -94.32 -68.93 6 3 THR A 23 ? ? -49.21 161.34 7 4 TYR A 20 ? ? -101.12 -68.84 8 5 TYR A 20 ? ? -94.25 -68.67 9 5 THR A 23 ? ? -49.60 162.20 10 6 TYR A 20 ? ? -96.13 -68.75 11 6 THR A 23 ? ? -48.84 162.39 12 6 LYS A 58 ? ? 60.80 62.60 13 7 TYR A 20 ? ? -100.97 -69.23 14 7 CYS A 21 ? ? -175.64 148.06 15 7 THR A 23 ? ? -49.87 161.56 16 8 TYR A 20 ? ? -94.08 -68.84 17 8 THR A 23 ? ? -49.75 161.92 18 8 LYS A 58 ? ? 62.88 62.41 19 9 TYR A 20 ? ? -96.95 -69.03 20 9 THR A 23 ? ? -49.42 162.31 21 10 TYR A 20 ? ? -94.12 -69.45 22 10 CYS A 21 ? ? -175.65 148.41 23 11 TYR A 20 ? ? -96.34 -69.28 24 11 THR A 23 ? ? -49.70 161.43 25 11 SER A 74 ? ? -66.79 -177.78 26 12 TYR A 20 ? ? -98.93 -69.54 27 12 THR A 23 ? ? -49.15 161.60 28 13 TYR A 20 ? ? -99.57 -69.30 29 13 CYS A 21 ? ? -175.77 148.60 30 13 THR A 23 ? ? -49.67 161.76 31 14 TYR A 20 ? ? -93.74 -68.91 32 14 THR A 23 ? ? -49.63 161.78 33 14 SER A 74 ? ? -55.61 172.27 34 15 TYR A 20 ? ? -95.87 -69.39 35 15 THR A 23 ? ? -49.35 161.79 36 16 TYR A 20 ? ? -93.60 -69.16 37 16 THR A 23 ? ? -49.10 162.25 38 17 TYR A 20 ? ? -96.56 -69.61 39 17 THR A 23 ? ? -49.08 162.50 40 18 TYR A 20 ? ? -98.17 -68.97 41 18 ALA A 42 ? ? -146.40 23.26 42 19 TYR A 20 ? ? -94.12 -68.93 43 19 CYS A 21 ? ? -174.87 149.15 44 19 THR A 23 ? ? -49.24 161.51 45 19 SER A 74 ? ? -55.43 175.81 46 20 ARG A 9 ? ? -59.26 -178.19 47 20 TYR A 20 ? ? -97.23 -69.28 48 20 CYS A 21 ? ? -175.35 148.51 49 20 THR A 23 ? ? -49.20 162.34 50 20 SER A 74 ? ? -69.40 -179.41 #