data_2N79 # _entry.id 2N79 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104510 RCSB ? ? 2N79 PDB pdb_00002n79 10.2210/pdb2n79/pdb 25797 BMRB ? 10.13018/BMR25797 D_1000104510 WWPDB ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-10-28 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Derived calculations' 3 2 'Structure model' Other 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_struct_conn_angle 4 2 'Structure model' struct_conn 5 2 'Structure model' struct_ref_seq_dif 6 2 'Structure model' struct_site 7 3 'Structure model' chem_comp_atom 8 3 'Structure model' chem_comp_bond 9 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 14 2 'Structure model' '_pdbx_struct_conn_angle.value' 15 2 'Structure model' '_struct_conn.pdbx_dist_value' 16 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 17 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 18 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 19 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 20 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 21 2 'Structure model' '_struct_ref_seq_dif.details' 22 2 'Structure model' '_struct_site.pdbx_auth_asym_id' 23 2 'Structure model' '_struct_site.pdbx_auth_comp_id' 24 2 'Structure model' '_struct_site.pdbx_auth_seq_id' 25 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2N79 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2015-09-06 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 2ctn PDB . unspecified 1ap4 PDB . unspecified 2mlf PDB . unspecified 1r2u PDB . unspecified 25797 BMRB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Robertson, I.M.' 1 'Sevrieva, I.' 2 'Li, M.X.' 3 'Irving, M.' 4 'Sun, Y.' 5 'Sykes, B.' 6 # _citation.id primary _citation.title 'The structural and functional effects of the familial hypertrophic cardiomyopathy-linked cardiac troponin C mutation, L29Q.' _citation.journal_abbrev J.MOL.CELL.CARDIOL. _citation.journal_volume 87 _citation.page_first 257 _citation.page_last 269 _citation.year 2015 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 0022-2828 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 26341255 _citation.pdbx_database_id_DOI 10.1016/j.yjmcc.2015.08.017 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Robertson, I.M.' 1 ? primary 'Sevrieva, I.' 2 ? primary 'Li, M.X.' 3 ? primary 'Irving, M.' 4 ? primary 'Sun, Y.B.' 5 ? primary 'Sykes, B.D.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Troponin C, slow skeletal and cardiac muscles' 10053.144 1 ? 'L29Q, C35S, C84S' ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name TN-C # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDDIYKAAVEQLTEEQKNEFKAAFDIFVQGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVM MVRSMKDDS ; _entity_poly.pdbx_seq_one_letter_code_can ;MDDIYKAAVEQLTEEQKNEFKAAFDIFVQGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVM MVRSMKDDS ; _entity_poly.pdbx_strand_id C _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 ASP n 1 4 ILE n 1 5 TYR n 1 6 LYS n 1 7 ALA n 1 8 ALA n 1 9 VAL n 1 10 GLU n 1 11 GLN n 1 12 LEU n 1 13 THR n 1 14 GLU n 1 15 GLU n 1 16 GLN n 1 17 LYS n 1 18 ASN n 1 19 GLU n 1 20 PHE n 1 21 LYS n 1 22 ALA n 1 23 ALA n 1 24 PHE n 1 25 ASP n 1 26 ILE n 1 27 PHE n 1 28 VAL n 1 29 GLN n 1 30 GLY n 1 31 ALA n 1 32 GLU n 1 33 ASP n 1 34 GLY n 1 35 SER n 1 36 ILE n 1 37 SER n 1 38 THR n 1 39 LYS n 1 40 GLU n 1 41 LEU n 1 42 GLY n 1 43 LYS n 1 44 VAL n 1 45 MET n 1 46 ARG n 1 47 MET n 1 48 LEU n 1 49 GLY n 1 50 GLN n 1 51 ASN n 1 52 PRO n 1 53 THR n 1 54 PRO n 1 55 GLU n 1 56 GLU n 1 57 LEU n 1 58 GLN n 1 59 GLU n 1 60 MET n 1 61 ILE n 1 62 ASP n 1 63 GLU n 1 64 VAL n 1 65 ASP n 1 66 GLU n 1 67 ASP n 1 68 GLY n 1 69 SER n 1 70 GLY n 1 71 THR n 1 72 VAL n 1 73 ASP n 1 74 PHE n 1 75 ASP n 1 76 GLU n 1 77 PHE n 1 78 LEU n 1 79 VAL n 1 80 MET n 1 81 MET n 1 82 VAL n 1 83 ARG n 1 84 SER n 1 85 MET n 1 86 LYS n 1 87 ASP n 1 88 ASP n 1 89 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TNNC1, TNNC' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET-3a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET C . n A 1 2 ASP 2 2 2 ASP ASP C . n A 1 3 ASP 3 3 3 ASP ASP C . n A 1 4 ILE 4 4 4 ILE ILE C . n A 1 5 TYR 5 5 5 TYR TYR C . n A 1 6 LYS 6 6 6 LYS LYS C . n A 1 7 ALA 7 7 7 ALA ALA C . n A 1 8 ALA 8 8 8 ALA ALA C . n A 1 9 VAL 9 9 9 VAL VAL C . n A 1 10 GLU 10 10 10 GLU GLU C . n A 1 11 GLN 11 11 11 GLN GLN C . n A 1 12 LEU 12 12 12 LEU LEU C . n A 1 13 THR 13 13 13 THR THR C . n A 1 14 GLU 14 14 14 GLU GLU C . n A 1 15 GLU 15 15 15 GLU GLU C . n A 1 16 GLN 16 16 16 GLN GLN C . n A 1 17 LYS 17 17 17 LYS LYS C . n A 1 18 ASN 18 18 18 ASN ASN C . n A 1 19 GLU 19 19 19 GLU GLU C . n A 1 20 PHE 20 20 20 PHE PHE C . n A 1 21 LYS 21 21 21 LYS LYS C . n A 1 22 ALA 22 22 22 ALA ALA C . n A 1 23 ALA 23 23 23 ALA ALA C . n A 1 24 PHE 24 24 24 PHE PHE C . n A 1 25 ASP 25 25 25 ASP ASP C . n A 1 26 ILE 26 26 26 ILE ILE C . n A 1 27 PHE 27 27 27 PHE PHE C . n A 1 28 VAL 28 28 28 VAL VAL C . n A 1 29 GLN 29 29 29 GLN GLN C . n A 1 30 GLY 30 30 30 GLY GLY C . n A 1 31 ALA 31 31 31 ALA ALA C . n A 1 32 GLU 32 32 32 GLU GLU C . n A 1 33 ASP 33 33 33 ASP ASP C . n A 1 34 GLY 34 34 34 GLY GLY C . n A 1 35 SER 35 35 35 SER SER C . n A 1 36 ILE 36 36 36 ILE ILE C . n A 1 37 SER 37 37 37 SER SER C . n A 1 38 THR 38 38 38 THR THR C . n A 1 39 LYS 39 39 39 LYS LYS C . n A 1 40 GLU 40 40 40 GLU GLU C . n A 1 41 LEU 41 41 41 LEU LEU C . n A 1 42 GLY 42 42 42 GLY GLY C . n A 1 43 LYS 43 43 43 LYS LYS C . n A 1 44 VAL 44 44 44 VAL VAL C . n A 1 45 MET 45 45 45 MET MET C . n A 1 46 ARG 46 46 46 ARG ARG C . n A 1 47 MET 47 47 47 MET MET C . n A 1 48 LEU 48 48 48 LEU LEU C . n A 1 49 GLY 49 49 49 GLY GLY C . n A 1 50 GLN 50 50 50 GLN GLN C . n A 1 51 ASN 51 51 51 ASN ASN C . n A 1 52 PRO 52 52 52 PRO PRO C . n A 1 53 THR 53 53 53 THR THR C . n A 1 54 PRO 54 54 54 PRO PRO C . n A 1 55 GLU 55 55 55 GLU GLU C . n A 1 56 GLU 56 56 56 GLU GLU C . n A 1 57 LEU 57 57 57 LEU LEU C . n A 1 58 GLN 58 58 58 GLN GLN C . n A 1 59 GLU 59 59 59 GLU GLU C . n A 1 60 MET 60 60 60 MET MET C . n A 1 61 ILE 61 61 61 ILE ILE C . n A 1 62 ASP 62 62 62 ASP ASP C . n A 1 63 GLU 63 63 63 GLU GLU C . n A 1 64 VAL 64 64 64 VAL VAL C . n A 1 65 ASP 65 65 65 ASP ASP C . n A 1 66 GLU 66 66 66 GLU GLU C . n A 1 67 ASP 67 67 67 ASP ASP C . n A 1 68 GLY 68 68 68 GLY GLY C . n A 1 69 SER 69 69 69 SER SER C . n A 1 70 GLY 70 70 70 GLY GLY C . n A 1 71 THR 71 71 71 THR THR C . n A 1 72 VAL 72 72 72 VAL VAL C . n A 1 73 ASP 73 73 73 ASP ASP C . n A 1 74 PHE 74 74 74 PHE PHE C . n A 1 75 ASP 75 75 75 ASP ASP C . n A 1 76 GLU 76 76 76 GLU GLU C . n A 1 77 PHE 77 77 77 PHE PHE C . n A 1 78 LEU 78 78 78 LEU LEU C . n A 1 79 VAL 79 79 79 VAL VAL C . n A 1 80 MET 80 80 80 MET MET C . n A 1 81 MET 81 81 81 MET MET C . n A 1 82 VAL 82 82 82 VAL VAL C . n A 1 83 ARG 83 83 83 ARG ARG C . n A 1 84 SER 84 84 84 SER SER C . n A 1 85 MET 85 85 85 MET MET C . n A 1 86 LYS 86 86 86 LYS LYS C . n A 1 87 ASP 87 87 87 ASP ASP C . n A 1 88 ASP 88 88 88 ASP ASP C . n A 1 89 SER 89 89 89 SER SER C . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id CA _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 101 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id CA _pdbx_nonpoly_scheme.auth_mon_id CA2 _pdbx_nonpoly_scheme.pdb_strand_id C _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2N79 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N79 _struct.title 'The structural and functional effects of the Familial Hypertrophic Cardiomyopathy-linked cardiac troponin C mutation, L29Q' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2N79 _struct_keywords.pdbx_keywords 'CONTRACTILE PROTEIN' _struct_keywords.text 'Cardiac, CONTRACTILE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TNNC1_HUMAN _struct_ref.pdbx_db_accession P63316 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVM MVRCMKDDS ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2N79 _struct_ref_seq.pdbx_strand_id C _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 89 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P63316 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 89 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 89 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2N79 GLN C 29 ? UNP P63316 LEU 29 'engineered mutation' 29 1 1 2N79 SER C 35 ? UNP P63316 CYS 35 'engineered mutation' 35 2 1 2N79 SER C 84 ? UNP P63316 CYS 84 'engineered mutation' 84 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 2 ? LEU A 12 ? ASP C 2 LEU C 12 1 ? 11 HELX_P HELX_P2 2 THR A 13 ? GLN A 29 ? THR C 13 GLN C 29 1 ? 17 HELX_P HELX_P3 3 THR A 38 ? GLY A 49 ? THR C 38 GLY C 49 1 ? 12 HELX_P HELX_P4 4 THR A 53 ? GLU A 63 ? THR C 53 GLU C 63 1 ? 11 HELX_P HELX_P5 5 ASP A 73 ? LYS A 86 ? ASP C 73 LYS C 86 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 65 OD2 ? ? ? 1_555 B CA . CA ? ? C ASP 65 C CA 101 1_555 ? ? ? ? ? ? ? 2.702 ? ? metalc2 metalc ? ? A ASP 67 OD1 ? ? ? 1_555 B CA . CA ? ? C ASP 67 C CA 101 1_555 ? ? ? ? ? ? ? 2.625 ? ? metalc3 metalc ? ? A ASP 67 OD2 ? ? ? 1_555 B CA . CA ? ? C ASP 67 C CA 101 1_555 ? ? ? ? ? ? ? 2.896 ? ? metalc4 metalc ? ? A SER 69 OG ? ? ? 1_555 B CA . CA ? ? C SER 69 C CA 101 1_555 ? ? ? ? ? ? ? 2.539 ? ? metalc5 metalc ? ? A THR 71 O ? ? ? 1_555 B CA . CA ? ? C THR 71 C CA 101 1_555 ? ? ? ? ? ? ? 2.584 ? ? metalc6 metalc ? ? A GLU 76 OE1 ? ? ? 1_555 B CA . CA ? ? C GLU 76 C CA 101 1_555 ? ? ? ? ? ? ? 2.644 ? ? metalc7 metalc ? ? A GLU 76 OE2 ? ? ? 1_555 B CA . CA ? ? C GLU 76 C CA 101 1_555 ? ? ? ? ? ? ? 2.807 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 65 ? C ASP 65 ? 1_555 CA ? B CA . ? C CA 101 ? 1_555 OD1 ? A ASP 67 ? C ASP 67 ? 1_555 89.7 ? 2 OD2 ? A ASP 65 ? C ASP 65 ? 1_555 CA ? B CA . ? C CA 101 ? 1_555 OD2 ? A ASP 67 ? C ASP 67 ? 1_555 114.1 ? 3 OD1 ? A ASP 67 ? C ASP 67 ? 1_555 CA ? B CA . ? C CA 101 ? 1_555 OD2 ? A ASP 67 ? C ASP 67 ? 1_555 45.4 ? 4 OD2 ? A ASP 65 ? C ASP 65 ? 1_555 CA ? B CA . ? C CA 101 ? 1_555 OG ? A SER 69 ? C SER 69 ? 1_555 76.9 ? 5 OD1 ? A ASP 67 ? C ASP 67 ? 1_555 CA ? B CA . ? C CA 101 ? 1_555 OG ? A SER 69 ? C SER 69 ? 1_555 94.9 ? 6 OD2 ? A ASP 67 ? C ASP 67 ? 1_555 CA ? B CA . ? C CA 101 ? 1_555 OG ? A SER 69 ? C SER 69 ? 1_555 65.8 ? 7 OD2 ? A ASP 65 ? C ASP 65 ? 1_555 CA ? B CA . ? C CA 101 ? 1_555 O ? A THR 71 ? C THR 71 ? 1_555 69.9 ? 8 OD1 ? A ASP 67 ? C ASP 67 ? 1_555 CA ? B CA . ? C CA 101 ? 1_555 O ? A THR 71 ? C THR 71 ? 1_555 159.4 ? 9 OD2 ? A ASP 67 ? C ASP 67 ? 1_555 CA ? B CA . ? C CA 101 ? 1_555 O ? A THR 71 ? C THR 71 ? 1_555 145.9 ? 10 OG ? A SER 69 ? C SER 69 ? 1_555 CA ? B CA . ? C CA 101 ? 1_555 O ? A THR 71 ? C THR 71 ? 1_555 83.4 ? 11 OD2 ? A ASP 65 ? C ASP 65 ? 1_555 CA ? B CA . ? C CA 101 ? 1_555 OE1 ? A GLU 76 ? C GLU 76 ? 1_555 66.9 ? 12 OD1 ? A ASP 67 ? C ASP 67 ? 1_555 CA ? B CA . ? C CA 101 ? 1_555 OE1 ? A GLU 76 ? C GLU 76 ? 1_555 104.3 ? 13 OD2 ? A ASP 67 ? C ASP 67 ? 1_555 CA ? B CA . ? C CA 101 ? 1_555 OE1 ? A GLU 76 ? C GLU 76 ? 1_555 148.1 ? 14 OG ? A SER 69 ? C SER 69 ? 1_555 CA ? B CA . ? C CA 101 ? 1_555 OE1 ? A GLU 76 ? C GLU 76 ? 1_555 138.5 ? 15 O ? A THR 71 ? C THR 71 ? 1_555 CA ? B CA . ? C CA 101 ? 1_555 OE1 ? A GLU 76 ? C GLU 76 ? 1_555 65.9 ? 16 OD2 ? A ASP 65 ? C ASP 65 ? 1_555 CA ? B CA . ? C CA 101 ? 1_555 OE2 ? A GLU 76 ? C GLU 76 ? 1_555 90.9 ? 17 OD1 ? A ASP 67 ? C ASP 67 ? 1_555 CA ? B CA . ? C CA 101 ? 1_555 OE2 ? A GLU 76 ? C GLU 76 ? 1_555 65.0 ? 18 OD2 ? A ASP 67 ? C ASP 67 ? 1_555 CA ? B CA . ? C CA 101 ? 1_555 OE2 ? A GLU 76 ? C GLU 76 ? 1_555 102.8 ? 19 OG ? A SER 69 ? C SER 69 ? 1_555 CA ? B CA . ? C CA 101 ? 1_555 OE2 ? A GLU 76 ? C GLU 76 ? 1_555 156.9 ? 20 O ? A THR 71 ? C THR 71 ? 1_555 CA ? B CA . ? C CA 101 ? 1_555 OE2 ? A GLU 76 ? C GLU 76 ? 1_555 111.1 ? 21 OE1 ? A GLU 76 ? C GLU 76 ? 1_555 CA ? B CA . ? C CA 101 ? 1_555 OE2 ? A GLU 76 ? C GLU 76 ? 1_555 46.2 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 36 ? SER A 37 ? ILE C 36 SER C 37 A 2 THR A 71 ? VAL A 72 ? THR C 71 VAL C 72 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 36 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id C _pdbx_struct_sheet_hbond.range_1_auth_seq_id 36 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 72 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id C _pdbx_struct_sheet_hbond.range_2_auth_seq_id 72 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id C _struct_site.pdbx_auth_comp_id CA _struct_site.pdbx_auth_seq_id 101 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'BINDING SITE FOR RESIDUE CA C 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ASP A 65 ? ASP C 65 . ? 1_555 ? 2 AC1 6 ASP A 67 ? ASP C 67 . ? 1_555 ? 3 AC1 6 SER A 69 ? SER C 69 . ? 1_555 ? 4 AC1 6 THR A 71 ? THR C 71 . ? 1_555 ? 5 AC1 6 ASP A 73 ? ASP C 73 . ? 1_555 ? 6 AC1 6 GLU A 76 ? GLU C 76 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP C 73 ? ? -107.16 -166.61 2 1 LYS C 86 ? ? 63.40 -74.45 3 1 ASP C 87 ? ? -106.85 -167.70 4 2 ASP C 87 ? ? -109.82 -168.48 5 3 ASP C 65 ? ? -65.84 96.10 6 3 ASP C 73 ? ? -117.39 -161.55 7 3 LYS C 86 ? ? 69.53 -2.72 8 4 ASP C 73 ? ? -117.41 -166.09 9 4 LYS C 86 ? ? 66.83 -72.39 10 4 ASP C 87 ? ? 62.34 -169.04 11 4 ASP C 88 ? ? 53.66 -147.56 12 5 ASP C 2 ? ? -90.55 58.68 13 5 ASP C 73 ? ? -115.40 -168.04 14 5 ASP C 87 ? ? -91.96 -77.13 15 6 ASP C 87 ? ? -126.02 -82.00 16 6 ASP C 88 ? ? 54.32 -165.24 17 7 ASP C 2 ? ? 60.55 85.67 18 7 ASP C 65 ? ? -67.61 96.23 19 7 ASP C 73 ? ? -118.37 -169.24 20 8 ASP C 2 ? ? -155.86 40.73 21 8 ASN C 51 ? ? -149.98 53.37 22 8 LYS C 86 ? ? -114.98 -130.42 23 9 ASP C 73 ? ? -117.99 -166.69 24 9 ASP C 87 ? ? 66.57 -71.09 25 10 ASN C 51 ? ? -143.45 49.36 26 10 ASP C 73 ? ? -99.82 -158.56 27 10 LYS C 86 ? ? 63.19 -68.52 28 11 ASP C 2 ? ? 53.16 79.13 29 11 ASP C 65 ? ? -65.47 97.53 30 11 ASP C 73 ? ? -119.10 -168.32 31 11 LYS C 86 ? ? -123.03 -164.76 32 12 ASP C 73 ? ? -109.82 -167.57 33 12 ASP C 87 ? ? 64.80 110.57 34 12 ASP C 88 ? ? 46.19 -152.44 35 13 ASP C 2 ? ? -110.94 -150.21 36 13 ASN C 51 ? ? -151.98 52.76 37 13 ASP C 73 ? ? -114.69 -161.08 38 15 ASP C 73 ? ? -109.54 -165.30 39 15 LYS C 86 ? ? 63.99 114.33 40 15 ASP C 87 ? ? 67.22 171.53 41 15 ASP C 88 ? ? 65.66 -76.21 42 16 ASP C 2 ? ? 57.72 -174.99 43 16 ASN C 51 ? ? -140.18 49.84 44 16 ASP C 73 ? ? -108.42 -160.04 45 17 ASN C 51 ? ? -140.50 46.29 46 17 ASP C 73 ? ? -111.66 -163.35 47 17 LYS C 86 ? ? 65.40 -73.80 48 18 ASN C 51 ? ? 32.21 57.88 49 18 LYS C 86 ? ? 59.62 89.86 50 19 ASP C 2 ? ? -134.88 -44.93 51 19 ASN C 51 ? ? -151.40 59.58 52 19 ASP C 73 ? ? -110.79 -168.41 53 19 ASP C 87 ? ? 65.31 -75.84 54 20 ASN C 51 ? ? -146.46 47.32 55 20 ASP C 65 ? ? -62.39 99.30 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG C 46 ? ? 0.282 'SIDE CHAIN' 2 1 ARG C 83 ? ? 0.302 'SIDE CHAIN' 3 2 ARG C 46 ? ? 0.305 'SIDE CHAIN' 4 2 ARG C 83 ? ? 0.317 'SIDE CHAIN' 5 3 ARG C 46 ? ? 0.315 'SIDE CHAIN' 6 3 ARG C 83 ? ? 0.249 'SIDE CHAIN' 7 4 ARG C 46 ? ? 0.312 'SIDE CHAIN' 8 4 ARG C 83 ? ? 0.294 'SIDE CHAIN' 9 5 ARG C 46 ? ? 0.287 'SIDE CHAIN' 10 5 ARG C 83 ? ? 0.302 'SIDE CHAIN' 11 6 ARG C 46 ? ? 0.302 'SIDE CHAIN' 12 6 ARG C 83 ? ? 0.315 'SIDE CHAIN' 13 7 ARG C 46 ? ? 0.308 'SIDE CHAIN' 14 7 ARG C 83 ? ? 0.309 'SIDE CHAIN' 15 8 ARG C 46 ? ? 0.302 'SIDE CHAIN' 16 8 ARG C 83 ? ? 0.256 'SIDE CHAIN' 17 9 ARG C 46 ? ? 0.317 'SIDE CHAIN' 18 9 ARG C 83 ? ? 0.316 'SIDE CHAIN' 19 10 ARG C 46 ? ? 0.312 'SIDE CHAIN' 20 10 ARG C 83 ? ? 0.315 'SIDE CHAIN' 21 11 ARG C 46 ? ? 0.287 'SIDE CHAIN' 22 11 ARG C 83 ? ? 0.309 'SIDE CHAIN' 23 12 ARG C 46 ? ? 0.297 'SIDE CHAIN' 24 12 ARG C 83 ? ? 0.212 'SIDE CHAIN' 25 13 ARG C 46 ? ? 0.302 'SIDE CHAIN' 26 13 ARG C 83 ? ? 0.316 'SIDE CHAIN' 27 14 ARG C 46 ? ? 0.249 'SIDE CHAIN' 28 14 ARG C 83 ? ? 0.310 'SIDE CHAIN' 29 15 ARG C 46 ? ? 0.321 'SIDE CHAIN' 30 15 ARG C 83 ? ? 0.307 'SIDE CHAIN' 31 16 ARG C 46 ? ? 0.257 'SIDE CHAIN' 32 16 ARG C 83 ? ? 0.304 'SIDE CHAIN' 33 17 ARG C 46 ? ? 0.314 'SIDE CHAIN' 34 17 ARG C 83 ? ? 0.316 'SIDE CHAIN' 35 18 ARG C 46 ? ? 0.309 'SIDE CHAIN' 36 18 ARG C 83 ? ? 0.322 'SIDE CHAIN' 37 19 ARG C 46 ? ? 0.316 'SIDE CHAIN' 38 19 ARG C 83 ? ? 0.287 'SIDE CHAIN' 39 20 ARG C 46 ? ? 0.278 'SIDE CHAIN' 40 20 ARG C 83 ? ? 0.319 'SIDE CHAIN' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2N79 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2N79 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '0.3-0.4 mM [U-95% 13C; U-95% 15N] protein_1, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # _pdbx_nmr_exptl_sample.component entity_1-1 _pdbx_nmr_exptl_sample.concentration ? _pdbx_nmr_exptl_sample.concentration_range 0.3-0.4 _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-95% 13C; U-95% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.126 _pdbx_nmr_exptl_sample_conditions.pH 6.7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D C(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '3D 1H-15N NOESY' 1 7 1 '3D 1H-13C NOESY' 1 8 1 '3D H(CCO)NH' 1 9 1 '3D 1H-13C NOESY aromatic' 1 10 1 '3D HNHA' 1 11 1 '3D HNHB' 1 12 1 'HN(CO)HB' # _pdbx_nmr_refine.entry_id 2N79 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_software.authors 'Brunger A. T. et.al.' _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name CNS _pdbx_nmr_software.version ? _pdbx_nmr_software.ordinal 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 ILE N N N N 138 ILE CA C N S 139 ILE C C N N 140 ILE O O N N 141 ILE CB C N S 142 ILE CG1 C N N 143 ILE CG2 C N N 144 ILE CD1 C N N 145 ILE OXT O N N 146 ILE H H N N 147 ILE H2 H N N 148 ILE HA H N N 149 ILE HB H N N 150 ILE HG12 H N N 151 ILE HG13 H N N 152 ILE HG21 H N N 153 ILE HG22 H N N 154 ILE HG23 H N N 155 ILE HD11 H N N 156 ILE HD12 H N N 157 ILE HD13 H N N 158 ILE HXT H N N 159 LEU N N N N 160 LEU CA C N S 161 LEU C C N N 162 LEU O O N N 163 LEU CB C N N 164 LEU CG C N N 165 LEU CD1 C N N 166 LEU CD2 C N N 167 LEU OXT O N N 168 LEU H H N N 169 LEU H2 H N N 170 LEU HA H N N 171 LEU HB2 H N N 172 LEU HB3 H N N 173 LEU HG H N N 174 LEU HD11 H N N 175 LEU HD12 H N N 176 LEU HD13 H N N 177 LEU HD21 H N N 178 LEU HD22 H N N 179 LEU HD23 H N N 180 LEU HXT H N N 181 LYS N N N N 182 LYS CA C N S 183 LYS C C N N 184 LYS O O N N 185 LYS CB C N N 186 LYS CG C N N 187 LYS CD C N N 188 LYS CE C N N 189 LYS NZ N N N 190 LYS OXT O N N 191 LYS H H N N 192 LYS H2 H N N 193 LYS HA H N N 194 LYS HB2 H N N 195 LYS HB3 H N N 196 LYS HG2 H N N 197 LYS HG3 H N N 198 LYS HD2 H N N 199 LYS HD3 H N N 200 LYS HE2 H N N 201 LYS HE3 H N N 202 LYS HZ1 H N N 203 LYS HZ2 H N N 204 LYS HZ3 H N N 205 LYS HXT H N N 206 MET N N N N 207 MET CA C N S 208 MET C C N N 209 MET O O N N 210 MET CB C N N 211 MET CG C N N 212 MET SD S N N 213 MET CE C N N 214 MET OXT O N N 215 MET H H N N 216 MET H2 H N N 217 MET HA H N N 218 MET HB2 H N N 219 MET HB3 H N N 220 MET HG2 H N N 221 MET HG3 H N N 222 MET HE1 H N N 223 MET HE2 H N N 224 MET HE3 H N N 225 MET HXT H N N 226 PHE N N N N 227 PHE CA C N S 228 PHE C C N N 229 PHE O O N N 230 PHE CB C N N 231 PHE CG C Y N 232 PHE CD1 C Y N 233 PHE CD2 C Y N 234 PHE CE1 C Y N 235 PHE CE2 C Y N 236 PHE CZ C Y N 237 PHE OXT O N N 238 PHE H H N N 239 PHE H2 H N N 240 PHE HA H N N 241 PHE HB2 H N N 242 PHE HB3 H N N 243 PHE HD1 H N N 244 PHE HD2 H N N 245 PHE HE1 H N N 246 PHE HE2 H N N 247 PHE HZ H N N 248 PHE HXT H N N 249 PRO N N N N 250 PRO CA C N S 251 PRO C C N N 252 PRO O O N N 253 PRO CB C N N 254 PRO CG C N N 255 PRO CD C N N 256 PRO OXT O N N 257 PRO H H N N 258 PRO HA H N N 259 PRO HB2 H N N 260 PRO HB3 H N N 261 PRO HG2 H N N 262 PRO HG3 H N N 263 PRO HD2 H N N 264 PRO HD3 H N N 265 PRO HXT H N N 266 SER N N N N 267 SER CA C N S 268 SER C C N N 269 SER O O N N 270 SER CB C N N 271 SER OG O N N 272 SER OXT O N N 273 SER H H N N 274 SER H2 H N N 275 SER HA H N N 276 SER HB2 H N N 277 SER HB3 H N N 278 SER HG H N N 279 SER HXT H N N 280 THR N N N N 281 THR CA C N S 282 THR C C N N 283 THR O O N N 284 THR CB C N R 285 THR OG1 O N N 286 THR CG2 C N N 287 THR OXT O N N 288 THR H H N N 289 THR H2 H N N 290 THR HA H N N 291 THR HB H N N 292 THR HG1 H N N 293 THR HG21 H N N 294 THR HG22 H N N 295 THR HG23 H N N 296 THR HXT H N N 297 TYR N N N N 298 TYR CA C N S 299 TYR C C N N 300 TYR O O N N 301 TYR CB C N N 302 TYR CG C Y N 303 TYR CD1 C Y N 304 TYR CD2 C Y N 305 TYR CE1 C Y N 306 TYR CE2 C Y N 307 TYR CZ C Y N 308 TYR OH O N N 309 TYR OXT O N N 310 TYR H H N N 311 TYR H2 H N N 312 TYR HA H N N 313 TYR HB2 H N N 314 TYR HB3 H N N 315 TYR HD1 H N N 316 TYR HD2 H N N 317 TYR HE1 H N N 318 TYR HE2 H N N 319 TYR HH H N N 320 TYR HXT H N N 321 VAL N N N N 322 VAL CA C N S 323 VAL C C N N 324 VAL O O N N 325 VAL CB C N N 326 VAL CG1 C N N 327 VAL CG2 C N N 328 VAL OXT O N N 329 VAL H H N N 330 VAL H2 H N N 331 VAL HA H N N 332 VAL HB H N N 333 VAL HG11 H N N 334 VAL HG12 H N N 335 VAL HG13 H N N 336 VAL HG21 H N N 337 VAL HG22 H N N 338 VAL HG23 H N N 339 VAL HXT H N N 340 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 ILE N CA sing N N 129 ILE N H sing N N 130 ILE N H2 sing N N 131 ILE CA C sing N N 132 ILE CA CB sing N N 133 ILE CA HA sing N N 134 ILE C O doub N N 135 ILE C OXT sing N N 136 ILE CB CG1 sing N N 137 ILE CB CG2 sing N N 138 ILE CB HB sing N N 139 ILE CG1 CD1 sing N N 140 ILE CG1 HG12 sing N N 141 ILE CG1 HG13 sing N N 142 ILE CG2 HG21 sing N N 143 ILE CG2 HG22 sing N N 144 ILE CG2 HG23 sing N N 145 ILE CD1 HD11 sing N N 146 ILE CD1 HD12 sing N N 147 ILE CD1 HD13 sing N N 148 ILE OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 MET N CA sing N N 195 MET N H sing N N 196 MET N H2 sing N N 197 MET CA C sing N N 198 MET CA CB sing N N 199 MET CA HA sing N N 200 MET C O doub N N 201 MET C OXT sing N N 202 MET CB CG sing N N 203 MET CB HB2 sing N N 204 MET CB HB3 sing N N 205 MET CG SD sing N N 206 MET CG HG2 sing N N 207 MET CG HG3 sing N N 208 MET SD CE sing N N 209 MET CE HE1 sing N N 210 MET CE HE2 sing N N 211 MET CE HE3 sing N N 212 MET OXT HXT sing N N 213 PHE N CA sing N N 214 PHE N H sing N N 215 PHE N H2 sing N N 216 PHE CA C sing N N 217 PHE CA CB sing N N 218 PHE CA HA sing N N 219 PHE C O doub N N 220 PHE C OXT sing N N 221 PHE CB CG sing N N 222 PHE CB HB2 sing N N 223 PHE CB HB3 sing N N 224 PHE CG CD1 doub Y N 225 PHE CG CD2 sing Y N 226 PHE CD1 CE1 sing Y N 227 PHE CD1 HD1 sing N N 228 PHE CD2 CE2 doub Y N 229 PHE CD2 HD2 sing N N 230 PHE CE1 CZ doub Y N 231 PHE CE1 HE1 sing N N 232 PHE CE2 CZ sing Y N 233 PHE CE2 HE2 sing N N 234 PHE CZ HZ sing N N 235 PHE OXT HXT sing N N 236 PRO N CA sing N N 237 PRO N CD sing N N 238 PRO N H sing N N 239 PRO CA C sing N N 240 PRO CA CB sing N N 241 PRO CA HA sing N N 242 PRO C O doub N N 243 PRO C OXT sing N N 244 PRO CB CG sing N N 245 PRO CB HB2 sing N N 246 PRO CB HB3 sing N N 247 PRO CG CD sing N N 248 PRO CG HG2 sing N N 249 PRO CG HG3 sing N N 250 PRO CD HD2 sing N N 251 PRO CD HD3 sing N N 252 PRO OXT HXT sing N N 253 SER N CA sing N N 254 SER N H sing N N 255 SER N H2 sing N N 256 SER CA C sing N N 257 SER CA CB sing N N 258 SER CA HA sing N N 259 SER C O doub N N 260 SER C OXT sing N N 261 SER CB OG sing N N 262 SER CB HB2 sing N N 263 SER CB HB3 sing N N 264 SER OG HG sing N N 265 SER OXT HXT sing N N 266 THR N CA sing N N 267 THR N H sing N N 268 THR N H2 sing N N 269 THR CA C sing N N 270 THR CA CB sing N N 271 THR CA HA sing N N 272 THR C O doub N N 273 THR C OXT sing N N 274 THR CB OG1 sing N N 275 THR CB CG2 sing N N 276 THR CB HB sing N N 277 THR OG1 HG1 sing N N 278 THR CG2 HG21 sing N N 279 THR CG2 HG22 sing N N 280 THR CG2 HG23 sing N N 281 THR OXT HXT sing N N 282 TYR N CA sing N N 283 TYR N H sing N N 284 TYR N H2 sing N N 285 TYR CA C sing N N 286 TYR CA CB sing N N 287 TYR CA HA sing N N 288 TYR C O doub N N 289 TYR C OXT sing N N 290 TYR CB CG sing N N 291 TYR CB HB2 sing N N 292 TYR CB HB3 sing N N 293 TYR CG CD1 doub Y N 294 TYR CG CD2 sing Y N 295 TYR CD1 CE1 sing Y N 296 TYR CD1 HD1 sing N N 297 TYR CD2 CE2 doub Y N 298 TYR CD2 HD2 sing N N 299 TYR CE1 CZ doub Y N 300 TYR CE1 HE1 sing N N 301 TYR CE2 CZ sing Y N 302 TYR CE2 HE2 sing N N 303 TYR CZ OH sing N N 304 TYR OH HH sing N N 305 TYR OXT HXT sing N N 306 VAL N CA sing N N 307 VAL N H sing N N 308 VAL N H2 sing N N 309 VAL CA C sing N N 310 VAL CA CB sing N N 311 VAL CA HA sing N N 312 VAL C O doub N N 313 VAL C OXT sing N N 314 VAL CB CG1 sing N N 315 VAL CB CG2 sing N N 316 VAL CB HB sing N N 317 VAL CG1 HG11 sing N N 318 VAL CG1 HG12 sing N N 319 VAL CG1 HG13 sing N N 320 VAL CG2 HG21 sing N N 321 VAL CG2 HG22 sing N N 322 VAL CG2 HG23 sing N N 323 VAL OXT HXT sing N N 324 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Varian INOVA 1 'Varian INOVA' 600 Varian UNITY 2 'Varian Unity' # _atom_sites.entry_id 2N79 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_