data_2NBQ # _entry.id 2NBQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104668 RCSB ? ? 2NBQ PDB pdb_00002nbq 10.2210/pdb2nbq/pdb 25985 BMRB ? ? D_1000104668 WWPDB ? ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 25985 _pdbx_database_related.db_name BMRB _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2NBQ _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2016-03-09 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Byeon, I.L.' 1 'Byeon, C.' 2 'Gronenborn, A.M.' 3 # _citation.id primary _citation.title ;Nuclear Magnetic Resonance Structure of the APOBEC3B Catalytic Domain: Structural Basis for Substrate Binding and DNA Deaminase Activity. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 55 _citation.page_first 2944 _citation.page_last 2959 _citation.year 2016 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 27163633 _citation.pdbx_database_id_DOI 10.1021/acs.biochem.6b00382 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Byeon, I.J.' 1 ? primary 'Byeon, C.H.' 2 ? primary 'Wu, T.' 3 ? primary 'Mitra, M.' 4 ? primary 'Singer, D.' 5 ? primary 'Levin, J.G.' 6 ? primary 'Gronenborn, A.M.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DNA dC->dU-editing enzyme APOBEC-3B' 24435.691 1 3.5.4.- ? 'residues 187-382' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'A3B, Phorbolin-1-related protein, Phorbolin-2/3' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEILRYLMDPDTFTFNFNNDPLVLRRRQTYLCYEVERLDNGTWVLMDQHMGFLCNEAKNLLCGFYGRHAELRFLDLVPSL QLDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQENTHVRLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFEYCW DTFVYRQGCPFQPWDGLEEHSQALSGRLRAILQNQGNLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MEILRYLMDPDTFTFNFNNDPLVLRRRQTYLCYEVERLDNGTWVLMDQHMGFLCNEAKNLLCGFYGRHAELRFLDLVPSL QLDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQENTHVRLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFEYCW DTFVYRQGCPFQPWDGLEEHSQALSGRLRAILQNQGNLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ILE n 1 4 LEU n 1 5 ARG n 1 6 TYR n 1 7 LEU n 1 8 MET n 1 9 ASP n 1 10 PRO n 1 11 ASP n 1 12 THR n 1 13 PHE n 1 14 THR n 1 15 PHE n 1 16 ASN n 1 17 PHE n 1 18 ASN n 1 19 ASN n 1 20 ASP n 1 21 PRO n 1 22 LEU n 1 23 VAL n 1 24 LEU n 1 25 ARG n 1 26 ARG n 1 27 ARG n 1 28 GLN n 1 29 THR n 1 30 TYR n 1 31 LEU n 1 32 CYS n 1 33 TYR n 1 34 GLU n 1 35 VAL n 1 36 GLU n 1 37 ARG n 1 38 LEU n 1 39 ASP n 1 40 ASN n 1 41 GLY n 1 42 THR n 1 43 TRP n 1 44 VAL n 1 45 LEU n 1 46 MET n 1 47 ASP n 1 48 GLN n 1 49 HIS n 1 50 MET n 1 51 GLY n 1 52 PHE n 1 53 LEU n 1 54 CYS n 1 55 ASN n 1 56 GLU n 1 57 ALA n 1 58 LYS n 1 59 ASN n 1 60 LEU n 1 61 LEU n 1 62 CYS n 1 63 GLY n 1 64 PHE n 1 65 TYR n 1 66 GLY n 1 67 ARG n 1 68 HIS n 1 69 ALA n 1 70 GLU n 1 71 LEU n 1 72 ARG n 1 73 PHE n 1 74 LEU n 1 75 ASP n 1 76 LEU n 1 77 VAL n 1 78 PRO n 1 79 SER n 1 80 LEU n 1 81 GLN n 1 82 LEU n 1 83 ASP n 1 84 PRO n 1 85 ALA n 1 86 GLN n 1 87 ILE n 1 88 TYR n 1 89 ARG n 1 90 VAL n 1 91 THR n 1 92 TRP n 1 93 PHE n 1 94 ILE n 1 95 SER n 1 96 TRP n 1 97 SER n 1 98 PRO n 1 99 CYS n 1 100 PHE n 1 101 SER n 1 102 TRP n 1 103 GLY n 1 104 CYS n 1 105 ALA n 1 106 GLY n 1 107 GLU n 1 108 VAL n 1 109 ARG n 1 110 ALA n 1 111 PHE n 1 112 LEU n 1 113 GLN n 1 114 GLU n 1 115 ASN n 1 116 THR n 1 117 HIS n 1 118 VAL n 1 119 ARG n 1 120 LEU n 1 121 ARG n 1 122 ILE n 1 123 PHE n 1 124 ALA n 1 125 ALA n 1 126 ARG n 1 127 ILE n 1 128 TYR n 1 129 ASP n 1 130 TYR n 1 131 ASP n 1 132 PRO n 1 133 LEU n 1 134 TYR n 1 135 LYS n 1 136 GLU n 1 137 ALA n 1 138 LEU n 1 139 GLN n 1 140 MET n 1 141 LEU n 1 142 ARG n 1 143 ASP n 1 144 ALA n 1 145 GLY n 1 146 ALA n 1 147 GLN n 1 148 VAL n 1 149 SER n 1 150 ILE n 1 151 MET n 1 152 THR n 1 153 TYR n 1 154 ASP n 1 155 GLU n 1 156 PHE n 1 157 GLU n 1 158 TYR n 1 159 CYS n 1 160 TRP n 1 161 ASP n 1 162 THR n 1 163 PHE n 1 164 VAL n 1 165 TYR n 1 166 ARG n 1 167 GLN n 1 168 GLY n 1 169 CYS n 1 170 PRO n 1 171 PHE n 1 172 GLN n 1 173 PRO n 1 174 TRP n 1 175 ASP n 1 176 GLY n 1 177 LEU n 1 178 GLU n 1 179 GLU n 1 180 HIS n 1 181 SER n 1 182 GLN n 1 183 ALA n 1 184 LEU n 1 185 SER n 1 186 GLY n 1 187 ARG n 1 188 LEU n 1 189 ARG n 1 190 ALA n 1 191 ILE n 1 192 LEU n 1 193 GLN n 1 194 ASN n 1 195 GLN n 1 196 GLY n 1 197 ASN n 1 198 LEU n 1 199 GLU n 1 200 HIS n 1 201 HIS n 1 202 HIS n 1 203 HIS n 1 204 HIS n 1 205 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene APOBEC3B _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain DE3 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET21 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ABC3B_HUMAN _struct_ref.pdbx_db_accession Q9UH17 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EILRYLMDPDTFTFNFNNDPLVLRRRQTYLCYEVERLDNGTWVLMDQHMGFLCNEAKNLLCGFYGRHAELRFLDLVPSLQ LDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQENTHVRLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFEYCWD TFVYRQGCPFQPWDGLEEHSQALSGRLRAILQNQGN ; _struct_ref.pdbx_align_begin 187 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2NBQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 197 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UH17 _struct_ref_seq.db_align_beg 187 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 382 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 187 _struct_ref_seq.pdbx_auth_seq_align_end 382 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2NBQ MET A 1 ? UNP Q9UH17 ? ? 'expression tag' 186 1 1 2NBQ LEU A 198 ? UNP Q9UH17 ? ? 'expression tag' 383 2 1 2NBQ GLU A 199 ? UNP Q9UH17 ? ? 'expression tag' 384 3 1 2NBQ HIS A 200 ? UNP Q9UH17 ? ? 'expression tag' 385 4 1 2NBQ HIS A 201 ? UNP Q9UH17 ? ? 'expression tag' 386 5 1 2NBQ HIS A 202 ? UNP Q9UH17 ? ? 'expression tag' 387 6 1 2NBQ HIS A 203 ? UNP Q9UH17 ? ? 'expression tag' 388 7 1 2NBQ HIS A 204 ? UNP Q9UH17 ? ? 'expression tag' 389 8 1 2NBQ HIS A 205 ? UNP Q9UH17 ? ? 'expression tag' 390 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '3D HNCA' 1 3 1 '3D HNCACB' 1 4 1 '3D HN(COCA)CB' 1 5 2 '2D 1H-15N HSQC' 1 6 2 '3D simultaneous 13C- and 15N-edited NOESY' 1 7 1 '3D TROSY-HNCACB' 1 8 1 '3D TROSY-HN(CO)CACB' 1 9 3 '2D 1H-1H NOESY' 1 10 2 '3D HCCH-TOCSY' 1 11 2 '2D 1H-13C HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pH 6.9 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.08 mM [U-13C; U-15N; U-2H] A3B_CTD, 0.08 mM Zinc, 10 mM DTT, 25 mM sodium phosphate, 93% H2O/7% D2O' 1 '93% H2O/7% D2O' '0.08 mM [U-100% 13C; U-100% 15N] A3B_CTD, 0.08 mM Zinc, 10 mM DTT, 25 mM sodium phosphate, 93% H2O/7% D2O' 2 '93% H2O/7% D2O' '0.05 mM A3B_CTD, 0.05 mM Zinc, 10 mM DTT, 25 mM sodium phosphate, 93% H2O/7% D2O' 3 '93% H2O/7% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 900 Bruker AVANCE 2 'Bruker Avance' 700 Bruker AVANCE 3 'Bruker Avance' 600 Bruker AVANCE 4 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2NBQ _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'THE FLEXIBLE (HEXA-HISTIDINE TAG) RESIDUES WERE NOT INCLUDED IN THE STRUCTURE CALCULATIONS AND THUS NOT SHOWN IN THE COORDINATES.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation 0.397 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 256 _pdbx_nmr_ensemble.conformers_submitted_total_number 30 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2NBQ _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation 0.5 _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 5 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.5 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2NBQ _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Schwieters, Kuszewski, Tjandra and Clore' 'chemical shift assignment' XPLOR-NIH ? 1 'Schwieters, Kuszewski, Tjandra and Clore' 'data analysis' XPLOR-NIH ? 2 'Schwieters, Kuszewski, Tjandra and Clore' 'peak picking' XPLOR-NIH ? 3 'Schwieters, Kuszewski, Tjandra and Clore' refinement XPLOR-NIH ? 4 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'NMR Structure of the APOBEC3B Catalytic Domain: Structural Bais for Substrate Binding and DNA Deaminase Activity' _exptl.entry_id 2NBQ _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2NBQ _struct.title 'NMR Structure of the C-Terminal Domain of human APOBEC3B' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2NBQ _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 10 ? PHE A 17 ? PRO A 195 PHE A 202 1 ? 8 HELX_P HELX_P2 2 ALA A 69 ? LEU A 80 ? ALA A 254 LEU A 265 1 ? 12 HELX_P HELX_P3 3 CYS A 104 ? GLU A 114 ? CYS A 289 GLU A 299 1 ? 11 HELX_P HELX_P4 7 TYR A 134 ? ALA A 144 ? TYR A 319 ALA A 329 1 ? 11 HELX_P HELX_P5 8 TYR A 153 ? PHE A 163 ? TYR A 338 PHE A 348 1 ? 11 HELX_P HELX_P6 9 GLY A 176 ? LEU A 192 ? GLY A 361 LEU A 377 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 68 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 253 A ZN 500 1_555 ? ? ? ? ? ? ? 2.301 ? ? metalc2 metalc ? ? A CYS 99 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 284 A ZN 500 1_555 ? ? ? ? ? ? ? 2.301 ? ? metalc3 metalc ? ? A CYS 104 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 289 A ZN 500 1_555 ? ? ? ? ? ? ? 2.299 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? parallel B 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 42 ? LEU A 45 ? THR A 227 LEU A 230 A 2 TYR A 30 ? ASP A 39 ? TYR A 215 ASP A 224 A 3 GLY A 51 ? CYS A 54 ? GLY A 236 CYS A 239 B 1 THR A 42 ? LEU A 45 ? THR A 227 LEU A 230 B 2 TYR A 30 ? ASP A 39 ? TYR A 215 ASP A 224 B 3 TYR A 88 ? ILE A 94 ? TYR A 273 ILE A 279 B 4 VAL A 118 ? ALA A 124 ? VAL A 303 ALA A 309 B 5 GLN A 147 ? ILE A 150 ? GLN A 332 ILE A 335 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O THR A 42 ? O THR A 227 N ASP A 39 ? N ASP A 224 A 2 3 N LEU A 31 ? N LEU A 216 O LEU A 53 ? O LEU A 238 B 1 2 O THR A 42 ? O THR A 227 N ASP A 39 ? N ASP A 224 B 2 3 N CYS A 32 ? N CYS A 217 O PHE A 93 ? O PHE A 278 B 3 4 N TRP A 92 ? N TRP A 277 O ARG A 121 ? O ARG A 306 B 4 5 N ILE A 122 ? N ILE A 307 O GLN A 147 ? O GLN A 332 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 500 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 500' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 HIS A 68 ? HIS A 253 . ? 1_555 ? 2 AC1 3 CYS A 99 ? CYS A 284 . ? 1_555 ? 3 AC1 3 CYS A 104 ? CYS A 289 . ? 1_555 ? # _atom_sites.entry_id 2NBQ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O Q S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 186 186 MET MET A . n A 1 2 GLU 2 187 187 GLU GLU A . n A 1 3 ILE 3 188 188 ILE ILE A . n A 1 4 LEU 4 189 189 LEU LEU A . n A 1 5 ARG 5 190 190 ARG ARG A . n A 1 6 TYR 6 191 191 TYR TYR A . n A 1 7 LEU 7 192 192 LEU LEU A . n A 1 8 MET 8 193 193 MET MET A . n A 1 9 ASP 9 194 194 ASP ASP A . n A 1 10 PRO 10 195 195 PRO PRO A . n A 1 11 ASP 11 196 196 ASP ASP A . n A 1 12 THR 12 197 197 THR THR A . n A 1 13 PHE 13 198 198 PHE PHE A . n A 1 14 THR 14 199 199 THR THR A . n A 1 15 PHE 15 200 200 PHE PHE A . n A 1 16 ASN 16 201 201 ASN ASN A . n A 1 17 PHE 17 202 202 PHE PHE A . n A 1 18 ASN 18 203 203 ASN ASN A . n A 1 19 ASN 19 204 204 ASN ASN A . n A 1 20 ASP 20 205 205 ASP ASP A . n A 1 21 PRO 21 206 206 PRO PRO A . n A 1 22 LEU 22 207 207 LEU LEU A . n A 1 23 VAL 23 208 208 VAL VAL A . n A 1 24 LEU 24 209 209 LEU LEU A . n A 1 25 ARG 25 210 210 ARG ARG A . n A 1 26 ARG 26 211 211 ARG ARG A . n A 1 27 ARG 27 212 212 ARG ARG A . n A 1 28 GLN 28 213 213 GLN GLN A . n A 1 29 THR 29 214 214 THR THR A . n A 1 30 TYR 30 215 215 TYR TYR A . n A 1 31 LEU 31 216 216 LEU LEU A . n A 1 32 CYS 32 217 217 CYS CYS A . n A 1 33 TYR 33 218 218 TYR TYR A . n A 1 34 GLU 34 219 219 GLU GLU A . n A 1 35 VAL 35 220 220 VAL VAL A . n A 1 36 GLU 36 221 221 GLU GLU A . n A 1 37 ARG 37 222 222 ARG ARG A . n A 1 38 LEU 38 223 223 LEU LEU A . n A 1 39 ASP 39 224 224 ASP ASP A . n A 1 40 ASN 40 225 225 ASN ASN A . n A 1 41 GLY 41 226 226 GLY GLY A . n A 1 42 THR 42 227 227 THR THR A . n A 1 43 TRP 43 228 228 TRP TRP A . n A 1 44 VAL 44 229 229 VAL VAL A . n A 1 45 LEU 45 230 230 LEU LEU A . n A 1 46 MET 46 231 231 MET MET A . n A 1 47 ASP 47 232 232 ASP ASP A . n A 1 48 GLN 48 233 233 GLN GLN A . n A 1 49 HIS 49 234 234 HIS HIS A . n A 1 50 MET 50 235 235 MET MET A . n A 1 51 GLY 51 236 236 GLY GLY A . n A 1 52 PHE 52 237 237 PHE PHE A . n A 1 53 LEU 53 238 238 LEU LEU A . n A 1 54 CYS 54 239 239 CYS CYS A . n A 1 55 ASN 55 240 240 ASN ASN A . n A 1 56 GLU 56 241 241 GLU GLU A . n A 1 57 ALA 57 242 242 ALA ALA A . n A 1 58 LYS 58 243 243 LYS LYS A . n A 1 59 ASN 59 244 244 ASN ASN A . n A 1 60 LEU 60 245 245 LEU LEU A . n A 1 61 LEU 61 246 246 LEU LEU A . n A 1 62 CYS 62 247 247 CYS CYS A . n A 1 63 GLY 63 248 248 GLY GLY A . n A 1 64 PHE 64 249 249 PHE PHE A . n A 1 65 TYR 65 250 250 TYR TYR A . n A 1 66 GLY 66 251 251 GLY GLY A . n A 1 67 ARG 67 252 252 ARG ARG A . n A 1 68 HIS 68 253 253 HIS HIS A . n A 1 69 ALA 69 254 254 ALA ALA A . n A 1 70 GLU 70 255 255 GLU GLU A . n A 1 71 LEU 71 256 256 LEU LEU A . n A 1 72 ARG 72 257 257 ARG ARG A . n A 1 73 PHE 73 258 258 PHE PHE A . n A 1 74 LEU 74 259 259 LEU LEU A . n A 1 75 ASP 75 260 260 ASP ASP A . n A 1 76 LEU 76 261 261 LEU LEU A . n A 1 77 VAL 77 262 262 VAL VAL A . n A 1 78 PRO 78 263 263 PRO PRO A . n A 1 79 SER 79 264 264 SER SER A . n A 1 80 LEU 80 265 265 LEU LEU A . n A 1 81 GLN 81 266 266 GLN GLN A . n A 1 82 LEU 82 267 267 LEU LEU A . n A 1 83 ASP 83 268 268 ASP ASP A . n A 1 84 PRO 84 269 269 PRO PRO A . n A 1 85 ALA 85 270 270 ALA ALA A . n A 1 86 GLN 86 271 271 GLN GLN A . n A 1 87 ILE 87 272 272 ILE ILE A . n A 1 88 TYR 88 273 273 TYR TYR A . n A 1 89 ARG 89 274 274 ARG ARG A . n A 1 90 VAL 90 275 275 VAL VAL A . n A 1 91 THR 91 276 276 THR THR A . n A 1 92 TRP 92 277 277 TRP TRP A . n A 1 93 PHE 93 278 278 PHE PHE A . n A 1 94 ILE 94 279 279 ILE ILE A . n A 1 95 SER 95 280 280 SER SER A . n A 1 96 TRP 96 281 281 TRP TRP A . n A 1 97 SER 97 282 282 SER SER A . n A 1 98 PRO 98 283 283 PRO PRO A . n A 1 99 CYS 99 284 284 CYS CYS A . n A 1 100 PHE 100 285 285 PHE PHE A . n A 1 101 SER 101 286 286 SER SER A . n A 1 102 TRP 102 287 287 TRP TRP A . n A 1 103 GLY 103 288 288 GLY GLY A . n A 1 104 CYS 104 289 289 CYS CYS A . n A 1 105 ALA 105 290 290 ALA ALA A . n A 1 106 GLY 106 291 291 GLY GLY A . n A 1 107 GLU 107 292 292 GLU GLU A . n A 1 108 VAL 108 293 293 VAL VAL A . n A 1 109 ARG 109 294 294 ARG ARG A . n A 1 110 ALA 110 295 295 ALA ALA A . n A 1 111 PHE 111 296 296 PHE PHE A . n A 1 112 LEU 112 297 297 LEU LEU A . n A 1 113 GLN 113 298 298 GLN GLN A . n A 1 114 GLU 114 299 299 GLU GLU A . n A 1 115 ASN 115 300 300 ASN ASN A . n A 1 116 THR 116 301 301 THR THR A . n A 1 117 HIS 117 302 302 HIS HIS A . n A 1 118 VAL 118 303 303 VAL VAL A . n A 1 119 ARG 119 304 304 ARG ARG A . n A 1 120 LEU 120 305 305 LEU LEU A . n A 1 121 ARG 121 306 306 ARG ARG A . n A 1 122 ILE 122 307 307 ILE ILE A . n A 1 123 PHE 123 308 308 PHE PHE A . n A 1 124 ALA 124 309 309 ALA ALA A . n A 1 125 ALA 125 310 310 ALA ALA A . n A 1 126 ARG 126 311 311 ARG ARG A . n A 1 127 ILE 127 312 312 ILE ILE A . n A 1 128 TYR 128 313 313 TYR TYR A . n A 1 129 ASP 129 314 314 ASP ASP A . n A 1 130 TYR 130 315 315 TYR TYR A . n A 1 131 ASP 131 316 316 ASP ASP A . n A 1 132 PRO 132 317 317 PRO PRO A . n A 1 133 LEU 133 318 318 LEU LEU A . n A 1 134 TYR 134 319 319 TYR TYR A . n A 1 135 LYS 135 320 320 LYS LYS A . n A 1 136 GLU 136 321 321 GLU GLU A . n A 1 137 ALA 137 322 322 ALA ALA A . n A 1 138 LEU 138 323 323 LEU LEU A . n A 1 139 GLN 139 324 324 GLN GLN A . n A 1 140 MET 140 325 325 MET MET A . n A 1 141 LEU 141 326 326 LEU LEU A . n A 1 142 ARG 142 327 327 ARG ARG A . n A 1 143 ASP 143 328 328 ASP ASP A . n A 1 144 ALA 144 329 329 ALA ALA A . n A 1 145 GLY 145 330 330 GLY GLY A . n A 1 146 ALA 146 331 331 ALA ALA A . n A 1 147 GLN 147 332 332 GLN GLN A . n A 1 148 VAL 148 333 333 VAL VAL A . n A 1 149 SER 149 334 334 SER SER A . n A 1 150 ILE 150 335 335 ILE ILE A . n A 1 151 MET 151 336 336 MET MET A . n A 1 152 THR 152 337 337 THR THR A . n A 1 153 TYR 153 338 338 TYR TYR A . n A 1 154 ASP 154 339 339 ASP ASP A . n A 1 155 GLU 155 340 340 GLU GLU A . n A 1 156 PHE 156 341 341 PHE PHE A . n A 1 157 GLU 157 342 342 GLU GLU A . n A 1 158 TYR 158 343 343 TYR TYR A . n A 1 159 CYS 159 344 344 CYS CYS A . n A 1 160 TRP 160 345 345 TRP TRP A . n A 1 161 ASP 161 346 346 ASP ASP A . n A 1 162 THR 162 347 347 THR THR A . n A 1 163 PHE 163 348 348 PHE PHE A . n A 1 164 VAL 164 349 349 VAL VAL A . n A 1 165 TYR 165 350 350 TYR TYR A . n A 1 166 ARG 166 351 351 ARG ARG A . n A 1 167 GLN 167 352 352 GLN GLN A . n A 1 168 GLY 168 353 353 GLY GLY A . n A 1 169 CYS 169 354 354 CYS CYS A . n A 1 170 PRO 170 355 355 PRO PRO A . n A 1 171 PHE 171 356 356 PHE PHE A . n A 1 172 GLN 172 357 357 GLN GLN A . n A 1 173 PRO 173 358 358 PRO PRO A . n A 1 174 TRP 174 359 359 TRP TRP A . n A 1 175 ASP 175 360 360 ASP ASP A . n A 1 176 GLY 176 361 361 GLY GLY A . n A 1 177 LEU 177 362 362 LEU LEU A . n A 1 178 GLU 178 363 363 GLU GLU A . n A 1 179 GLU 179 364 364 GLU GLU A . n A 1 180 HIS 180 365 365 HIS HIS A . n A 1 181 SER 181 366 366 SER SER A . n A 1 182 GLN 182 367 367 GLN GLN A . n A 1 183 ALA 183 368 368 ALA ALA A . n A 1 184 LEU 184 369 369 LEU LEU A . n A 1 185 SER 185 370 370 SER SER A . n A 1 186 GLY 186 371 371 GLY GLY A . n A 1 187 ARG 187 372 372 ARG ARG A . n A 1 188 LEU 188 373 373 LEU LEU A . n A 1 189 ARG 189 374 374 ARG ARG A . n A 1 190 ALA 190 375 375 ALA ALA A . n A 1 191 ILE 191 376 376 ILE ILE A . n A 1 192 LEU 192 377 377 LEU LEU A . n A 1 193 GLN 193 378 378 GLN GLN A . n A 1 194 ASN 194 379 379 ASN ASN A . n A 1 195 GLN 195 380 380 GLN GLN A . n A 1 196 GLY 196 381 381 GLY GLY A . n A 1 197 ASN 197 382 382 ASN ASN A . n A 1 198 LEU 198 383 ? ? ? A . n A 1 199 GLU 199 384 ? ? ? A . n A 1 200 HIS 200 385 ? ? ? A . n A 1 201 HIS 201 386 ? ? ? A . n A 1 202 HIS 202 387 ? ? ? A . n A 1 203 HIS 203 388 ? ? ? A . n A 1 204 HIS 204 389 ? ? ? A . n A 1 205 HIS 205 390 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 500 _pdbx_nonpoly_scheme.auth_seq_num 500 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 68 ? A HIS 253 ? 1_555 ZN ? B ZN . ? A ZN 500 ? 1_555 SG ? A CYS 99 ? A CYS 284 ? 1_555 109.1 ? 2 ND1 ? A HIS 68 ? A HIS 253 ? 1_555 ZN ? B ZN . ? A ZN 500 ? 1_555 SG ? A CYS 104 ? A CYS 289 ? 1_555 109.4 ? 3 SG ? A CYS 99 ? A CYS 284 ? 1_555 ZN ? B ZN . ? A ZN 500 ? 1_555 SG ? A CYS 104 ? A CYS 289 ? 1_555 108.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-06-01 2 'Structure model' 1 1 2016-06-29 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Derived calculations' 6 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_remark 3 3 'Structure model' pdbx_database_status 4 3 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' pdbx_struct_conn_angle 6 3 'Structure model' struct_conn 7 3 'Structure model' struct_ref_seq_dif 8 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_remark.text' 4 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 16 3 'Structure model' '_pdbx_struct_conn_angle.value' 17 3 'Structure model' '_struct_conn.pdbx_dist_value' 18 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 19 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 20 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 3 'Structure model' '_struct_ref_seq_dif.details' 24 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 25 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 26 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_database_remark.id _pdbx_database_remark.text 650 ;HELIX DETERMINATION METHOD: AUTHOR ; 700 ;SHEET DETERMINATION METHOD: AUTHOR ; # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.031 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.002 _pdbx_nmr_ensemble_rms.entry_id 2NBQ _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id A3B_CTD-1 0.08 ? mM '[U-13C; U-15N; U-2H]' 1 Zinc-2 0.08 ? mM ? 1 D2O-3 7 ? % '[U-100% 2H]' 1 H2O-4 93 ? % ? 1 DTT-5 10 ? mM ? 1 'sodium phosphate-6' 25 ? mM ? 1 A3B_CTD-7 0.08 ? mM '[U-100% 13C; U-100% 15N]' 2 Zinc-8 0.08 ? mM ? 2 D2O-9 7 ? % '[U-100% 2H]' 2 H2O-10 93 ? % ? 2 DTT-11 10 ? mM ? 2 'sodium phosphate-12' 25 ? mM ? 2 A3B_CTD-13 0.05 ? mM ? 3 Zinc-14 0.05 ? mM ? 3 D2O-15 7 ? % '[U-100% 2H]' 3 H2O-16 93 ? % ? 3 DTT-17 10 ? mM ? 3 'sodium phosphate-18' 25 ? mM ? 3 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2NBQ _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 168 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total ? _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count ? _pdbx_nmr_constraints.NOE_long_range_total_count ? _pdbx_nmr_constraints.NOE_medium_range_total_count ? _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count ? _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 155 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 154 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 HH21 A ARG 212 ? ? HD22 A ASN 240 ? ? 1.31 2 10 HG1 A THR 214 ? ? H A TYR 215 ? ? 1.30 3 13 HD21 A ASN 201 ? ? HH12 A ARG 210 ? ? 1.27 4 17 HE A ARG 351 ? ? H A GLN 352 ? ? 1.31 5 20 HH12 A ARG 211 ? ? HG1 A THR 214 ? ? 1.33 6 21 HH21 A ARG 210 ? ? HE A ARG 212 ? ? 1.34 7 24 HE A ARG 351 ? ? H A GLY 353 ? ? 1.18 8 27 H2 A MET 186 ? ? H A GLU 187 ? ? 1.29 9 29 O A TRP 359 ? ? H A GLY 361 ? ? 1.57 10 30 HG A SER 366 ? ? HE22 A GLN 367 ? ? 1.28 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 190 ? ? -125.87 -154.53 2 1 TYR A 191 ? ? -170.96 -42.76 3 1 LEU A 192 ? ? 38.29 92.54 4 1 MET A 193 ? ? -45.51 162.20 5 1 ASN A 204 ? ? 39.75 -114.92 6 1 LEU A 209 ? ? -129.95 -60.60 7 1 ARG A 211 ? ? -75.64 47.56 8 1 ARG A 212 ? ? -138.19 -48.76 9 1 LEU A 223 ? ? -64.90 97.64 10 1 CYS A 239 ? ? -106.72 -166.50 11 1 ASN A 240 ? ? -70.74 -77.78 12 1 ALA A 242 ? ? -145.42 -145.50 13 1 GLN A 266 ? ? 39.01 54.23 14 1 LEU A 267 ? ? -61.42 -179.48 15 1 ALA A 270 ? ? -83.44 -70.13 16 1 GLN A 271 ? ? -66.55 -178.17 17 1 ARG A 274 ? ? -162.34 112.33 18 1 SER A 280 ? ? -78.92 24.31 19 1 TRP A 281 ? ? -164.23 -160.67 20 1 PRO A 283 ? ? -49.01 161.03 21 1 SER A 286 ? ? -65.65 -82.16 22 1 CYS A 289 ? ? -98.55 -70.61 23 1 ARG A 351 ? ? -150.90 87.06 24 1 GLN A 352 ? ? 45.73 21.29 25 1 PRO A 358 ? ? -80.37 -78.00 26 1 TRP A 359 ? ? -156.47 -80.54 27 1 ASP A 360 ? ? -176.15 -31.79 28 1 LEU A 377 ? ? -65.59 6.94 29 1 GLN A 378 ? ? -122.68 -66.01 30 1 ASN A 379 ? ? 40.28 86.91 31 2 GLU A 187 ? ? 49.86 177.81 32 2 ASP A 205 ? ? -172.67 66.87 33 2 PRO A 206 ? ? -48.33 81.61 34 2 LEU A 207 ? ? -132.86 -75.47 35 2 VAL A 208 ? ? -153.50 54.77 36 2 ARG A 210 ? ? -150.56 -38.20 37 2 ARG A 212 ? ? -162.78 -47.99 38 2 LEU A 223 ? ? -69.13 96.90 39 2 HIS A 234 ? ? -143.69 26.90 40 2 ASN A 240 ? ? -93.48 40.90 41 2 ALA A 242 ? ? 166.12 163.54 42 2 ASN A 244 ? ? -154.90 9.11 43 2 LEU A 267 ? ? -52.16 170.25 44 2 PRO A 269 ? ? -46.84 -8.28 45 2 GLN A 271 ? ? -134.94 -156.20 46 2 ARG A 274 ? ? -168.88 118.62 47 2 SER A 280 ? ? -85.95 44.47 48 2 TRP A 281 ? ? 172.13 -166.26 49 2 CYS A 284 ? ? -74.24 -75.75 50 2 SER A 286 ? ? -38.33 -76.76 51 2 TYR A 315 ? ? -64.42 3.19 52 2 GLN A 352 ? ? 70.69 69.09 53 2 TRP A 359 ? ? 37.75 -89.16 54 2 ASP A 360 ? ? -170.31 -29.88 55 2 GLN A 380 ? ? -137.90 -145.03 56 3 ARG A 190 ? ? -95.91 -148.98 57 3 TYR A 191 ? ? -172.03 -51.84 58 3 LEU A 192 ? ? 41.46 98.03 59 3 PHE A 202 ? ? -49.88 -15.91 60 3 LEU A 223 ? ? -67.88 99.03 61 3 HIS A 234 ? ? -146.70 22.67 62 3 ASN A 240 ? ? -82.68 41.21 63 3 ASN A 244 ? ? -155.25 10.25 64 3 GLN A 266 ? ? 39.49 53.93 65 3 PRO A 269 ? ? -48.98 -8.09 66 3 GLN A 271 ? ? -125.89 -156.44 67 3 SER A 280 ? ? -98.44 32.89 68 3 TRP A 281 ? ? 162.16 113.72 69 3 SER A 282 ? ? -35.08 160.43 70 3 CYS A 284 ? ? -60.08 -143.14 71 3 SER A 286 ? ? -38.67 -72.48 72 3 TRP A 287 ? ? -43.54 -17.32 73 3 TYR A 313 ? ? -62.08 73.04 74 3 ASP A 314 ? ? -55.82 -5.06 75 3 PRO A 317 ? ? -48.98 -8.17 76 3 PRO A 355 ? ? -45.72 172.22 77 3 PRO A 358 ? ? -82.85 30.31 78 3 TRP A 359 ? ? 35.26 -88.48 79 3 ASP A 360 ? ? -171.45 -29.80 80 3 LEU A 377 ? ? -68.95 7.67 81 4 GLU A 187 ? ? 60.75 147.16 82 4 LEU A 189 ? ? 64.74 -164.68 83 4 LEU A 192 ? ? 51.48 90.61 84 4 MET A 193 ? ? -48.79 179.29 85 4 ASN A 203 ? ? -49.61 -11.61 86 4 ASN A 204 ? ? 59.72 84.93 87 4 PRO A 206 ? ? -49.50 102.13 88 4 ARG A 210 ? ? -58.92 -167.17 89 4 ARG A 211 ? ? 54.99 6.13 90 4 ARG A 212 ? ? -136.13 -74.60 91 4 LEU A 223 ? ? -63.86 98.79 92 4 HIS A 234 ? ? -147.14 13.83 93 4 LYS A 243 ? ? -101.14 -61.06 94 4 ASN A 244 ? ? -42.31 109.75 95 4 SER A 280 ? ? -98.40 36.27 96 4 TRP A 281 ? ? 160.59 121.65 97 4 SER A 282 ? ? -40.79 165.94 98 4 PRO A 283 ? ? -49.31 169.61 99 4 SER A 286 ? ? -72.31 -76.59 100 4 TRP A 287 ? ? -52.46 -9.77 101 4 CYS A 289 ? ? -98.18 -71.34 102 4 TYR A 313 ? ? -56.10 94.25 103 4 ASP A 314 ? ? -43.61 -19.17 104 4 ASP A 316 ? ? -152.30 79.47 105 4 TYR A 319 ? ? -49.24 -19.90 106 4 ARG A 351 ? ? -155.99 23.98 107 4 TRP A 359 ? ? 41.41 11.54 108 4 ASP A 360 ? ? 47.13 10.17 109 4 LEU A 377 ? ? -66.59 7.69 110 4 GLN A 378 ? ? -147.12 50.50 111 4 GLN A 380 ? ? 57.32 -143.43 112 5 TYR A 191 ? ? -174.95 130.18 113 5 ASN A 204 ? ? 53.23 106.11 114 5 LEU A 207 ? ? -65.00 83.78 115 5 ARG A 210 ? ? 44.26 -94.47 116 5 ARG A 211 ? ? -146.94 33.85 117 5 LEU A 223 ? ? -64.99 98.54 118 5 LYS A 243 ? ? -88.60 -152.68 119 5 GLN A 266 ? ? 38.70 53.99 120 5 PRO A 269 ? ? -48.36 -7.70 121 5 GLN A 271 ? ? -113.93 -156.67 122 5 ARG A 274 ? ? -161.03 117.61 123 5 SER A 280 ? ? -83.26 42.98 124 5 TRP A 281 ? ? 175.19 -163.62 125 5 CYS A 284 ? ? -100.24 -162.30 126 5 SER A 286 ? ? -65.03 -70.99 127 5 TRP A 287 ? ? -38.40 -25.48 128 5 CYS A 289 ? ? -98.95 -71.87 129 5 ARG A 311 ? ? -174.26 141.41 130 5 ARG A 351 ? ? -177.39 47.92 131 5 GLN A 352 ? ? 70.46 31.03 132 5 PRO A 355 ? ? -44.58 151.65 133 5 PRO A 358 ? ? -82.71 38.88 134 5 TRP A 359 ? ? 34.42 -87.05 135 5 ASP A 360 ? ? 163.01 -19.97 136 5 GLN A 378 ? ? -108.73 -73.26 137 5 ASN A 379 ? ? 52.62 175.10 138 5 GLN A 380 ? ? -58.85 172.65 139 6 TYR A 191 ? ? -150.73 -40.39 140 6 LEU A 192 ? ? 49.26 100.49 141 6 PRO A 206 ? ? -48.19 -179.77 142 6 LEU A 207 ? ? -92.29 35.56 143 6 VAL A 208 ? ? -73.65 -103.78 144 6 ARG A 210 ? ? -68.05 6.85 145 6 ARG A 211 ? ? -154.12 33.16 146 6 ARG A 212 ? ? 58.68 18.52 147 6 GLN A 213 ? ? -64.15 83.17 148 6 THR A 214 ? ? -113.92 -156.93 149 6 LEU A 223 ? ? -63.02 98.31 150 6 CYS A 239 ? ? -100.89 -169.71 151 6 ALA A 242 ? ? -172.01 55.20 152 6 ASN A 244 ? ? -42.29 92.37 153 6 GLN A 271 ? ? -102.50 -157.54 154 6 ARG A 274 ? ? -162.88 109.23 155 6 SER A 280 ? ? -88.83 36.50 156 6 TRP A 281 ? ? -178.46 -164.45 157 6 CYS A 284 ? ? -93.24 -159.28 158 6 PHE A 285 ? ? -56.13 172.42 159 6 SER A 286 ? ? -64.68 -71.23 160 6 TRP A 287 ? ? -38.78 -23.91 161 6 CYS A 289 ? ? -98.74 -71.19 162 6 GLN A 352 ? ? 71.36 45.00 163 6 PRO A 358 ? ? -84.34 32.88 164 6 TRP A 359 ? ? 34.80 -88.90 165 6 ASP A 360 ? ? -172.78 -30.68 166 6 GLN A 378 ? ? -146.29 59.36 167 7 ARG A 190 ? ? 58.57 145.03 168 7 TYR A 191 ? ? -137.42 -44.16 169 7 LEU A 192 ? ? 46.71 99.29 170 7 MET A 193 ? ? -41.07 161.76 171 7 ASN A 204 ? ? 178.23 154.17 172 7 PRO A 206 ? ? -38.11 103.66 173 7 LEU A 209 ? ? -175.13 137.94 174 7 ARG A 210 ? ? -74.57 33.38 175 7 GLN A 213 ? ? -43.93 94.27 176 7 THR A 214 ? ? -133.78 -156.11 177 7 HIS A 234 ? ? -142.19 49.66 178 7 ASN A 240 ? ? -50.44 -70.49 179 7 ALA A 242 ? ? -155.51 59.37 180 7 LYS A 243 ? ? 65.55 -156.98 181 7 LEU A 246 ? ? -57.35 -9.10 182 7 LEU A 265 ? ? -68.00 2.47 183 7 PRO A 269 ? ? -47.80 -6.59 184 7 GLN A 271 ? ? -118.18 -167.21 185 7 TRP A 281 ? ? -168.90 -163.63 186 7 PRO A 283 ? ? -49.68 174.84 187 7 CYS A 284 ? ? -99.20 -78.64 188 7 SER A 286 ? ? -42.09 -84.53 189 7 TRP A 287 ? ? -52.32 -9.83 190 7 CYS A 289 ? ? -99.46 -65.18 191 7 ASP A 316 ? ? -162.92 79.68 192 7 PRO A 317 ? ? -79.43 24.95 193 7 GLN A 352 ? ? 46.88 25.28 194 7 TRP A 359 ? ? 34.57 -87.72 195 7 ASP A 360 ? ? -171.62 -29.27 196 7 LEU A 377 ? ? -68.71 7.64 197 7 GLN A 378 ? ? -142.19 -62.12 198 7 ASN A 379 ? ? 39.97 -161.17 199 8 GLU A 187 ? ? 55.45 113.14 200 8 TYR A 191 ? ? -177.80 139.16 201 8 ASN A 204 ? ? -65.26 78.22 202 8 LEU A 207 ? ? 54.08 167.44 203 8 ASN A 240 ? ? -64.33 -79.15 204 8 ALA A 242 ? ? -172.26 102.71 205 8 LYS A 243 ? ? 45.29 94.73 206 8 ASN A 244 ? ? -142.60 -43.76 207 8 LEU A 259 ? ? -44.69 -19.84 208 8 GLN A 271 ? ? -103.89 -156.84 209 8 SER A 280 ? ? -96.22 36.53 210 8 TRP A 281 ? ? 162.29 119.88 211 8 SER A 282 ? ? -36.45 156.40 212 8 CYS A 284 ? ? -77.44 -152.67 213 8 SER A 286 ? ? -30.14 -76.44 214 8 TRP A 287 ? ? -35.73 -25.43 215 8 CYS A 289 ? ? -97.77 -72.36 216 8 ASP A 314 ? ? -45.97 -14.35 217 8 ARG A 351 ? ? -150.77 89.13 218 8 GLN A 352 ? ? 46.30 26.54 219 8 PRO A 355 ? ? -45.32 161.59 220 8 TRP A 359 ? ? 41.52 11.32 221 8 ASP A 360 ? ? 46.27 10.14 222 8 GLN A 380 ? ? -150.57 -6.64 223 9 ARG A 190 ? ? -83.31 -132.00 224 9 TYR A 191 ? ? -159.30 -44.09 225 9 LEU A 192 ? ? 56.53 114.37 226 9 MET A 193 ? ? -40.52 156.67 227 9 ASN A 204 ? ? -169.05 -50.27 228 9 LEU A 207 ? ? -41.55 162.81 229 9 VAL A 208 ? ? -63.76 -119.58 230 9 LEU A 209 ? ? 41.54 89.94 231 9 ARG A 210 ? ? 41.53 -156.24 232 9 THR A 214 ? ? -142.34 -157.21 233 9 ASN A 240 ? ? -44.19 -74.60 234 9 ALA A 242 ? ? -170.84 101.25 235 9 LYS A 243 ? ? 49.82 -173.02 236 9 ALA A 270 ? ? -59.36 -76.72 237 9 ARG A 274 ? ? -162.39 104.16 238 9 SER A 280 ? ? -98.58 41.92 239 9 TRP A 281 ? ? 166.19 142.03 240 9 SER A 282 ? ? -41.85 160.96 241 9 CYS A 284 ? ? -67.47 -118.39 242 9 SER A 286 ? ? -52.04 -82.27 243 9 TRP A 287 ? ? -37.72 -25.90 244 9 CYS A 289 ? ? -98.88 -61.47 245 9 TYR A 313 ? ? -64.20 80.91 246 9 ASP A 314 ? ? -43.31 -19.26 247 9 ASP A 316 ? ? -154.65 79.42 248 9 PRO A 317 ? ? -79.16 28.35 249 9 PRO A 355 ? ? -45.12 171.94 250 9 PRO A 358 ? ? -83.11 31.52 251 9 TRP A 359 ? ? 35.20 -88.13 252 9 ASP A 360 ? ? -171.77 -29.52 253 9 GLN A 380 ? ? 48.83 -153.85 254 10 GLU A 187 ? ? -44.48 153.20 255 10 LEU A 189 ? ? 52.14 86.33 256 10 TYR A 191 ? ? 68.66 -71.67 257 10 LEU A 192 ? ? 43.93 92.85 258 10 MET A 193 ? ? -57.98 -179.92 259 10 PRO A 206 ? ? -86.62 34.45 260 10 VAL A 208 ? ? -148.04 -43.78 261 10 ARG A 210 ? ? 65.49 101.97 262 10 ARG A 211 ? ? -176.24 101.73 263 10 GLN A 213 ? ? -55.49 82.86 264 10 THR A 214 ? ? -102.79 -167.66 265 10 LEU A 223 ? ? -65.36 100.00 266 10 HIS A 234 ? ? -150.83 19.28 267 10 ASN A 240 ? ? -54.78 -77.04 268 10 LYS A 243 ? ? -46.91 104.04 269 10 ASN A 244 ? ? -149.15 -13.91 270 10 GLN A 271 ? ? -137.99 -158.76 271 10 TRP A 281 ? ? 165.43 126.86 272 10 SER A 282 ? ? -36.61 158.47 273 10 CYS A 284 ? ? -60.26 -143.76 274 10 SER A 286 ? ? -39.77 -72.48 275 10 ARG A 311 ? ? -172.96 146.37 276 10 ASP A 316 ? ? -156.64 79.24 277 10 PRO A 317 ? ? -80.48 30.87 278 10 MET A 336 ? ? -46.79 158.48 279 10 GLN A 352 ? ? 42.96 28.56 280 10 TRP A 359 ? ? 40.84 12.38 281 10 ASP A 360 ? ? 46.23 10.65 282 10 GLN A 378 ? ? -97.90 -65.92 283 10 ASN A 379 ? ? 43.35 19.31 284 10 GLN A 380 ? ? 72.37 -44.66 285 11 GLU A 187 ? ? 61.29 155.86 286 11 ARG A 190 ? ? -138.30 -151.27 287 11 TYR A 191 ? ? -165.85 -40.92 288 11 LEU A 192 ? ? 41.72 99.43 289 11 ASN A 204 ? ? -72.18 38.23 290 11 LEU A 207 ? ? -41.91 92.03 291 11 ARG A 212 ? ? -45.81 -17.32 292 11 LEU A 223 ? ? -64.09 98.66 293 11 ASN A 244 ? ? -149.76 -13.02 294 11 GLN A 266 ? ? 38.40 54.22 295 11 LEU A 267 ? ? -58.48 -176.98 296 11 ALA A 270 ? ? -85.64 -71.76 297 11 ARG A 274 ? ? -166.18 117.29 298 11 SER A 280 ? ? -90.72 40.70 299 11 TRP A 281 ? ? -179.66 -171.95 300 11 PRO A 283 ? ? -48.57 168.85 301 11 CYS A 284 ? ? -63.31 -146.50 302 11 SER A 286 ? ? -44.33 -74.16 303 11 CYS A 289 ? ? -98.68 -61.79 304 11 ASP A 316 ? ? -151.84 70.13 305 11 ARG A 351 ? ? -151.97 15.58 306 11 PRO A 355 ? ? -44.92 158.66 307 11 PRO A 358 ? ? -82.00 39.00 308 11 TRP A 359 ? ? 34.47 -91.78 309 11 ASP A 360 ? ? 170.36 -25.22 310 11 LEU A 377 ? ? -68.19 7.82 311 12 GLU A 187 ? ? 56.75 162.23 312 12 ARG A 190 ? ? -139.31 -157.80 313 12 TYR A 191 ? ? -173.74 -46.58 314 12 LEU A 192 ? ? 39.30 96.47 315 12 ASN A 204 ? ? -59.43 -86.33 316 12 LEU A 207 ? ? 78.36 -32.75 317 12 VAL A 208 ? ? -150.91 70.33 318 12 ARG A 211 ? ? 47.63 15.11 319 12 THR A 214 ? ? -157.26 -156.17 320 12 LEU A 223 ? ? -64.68 97.57 321 12 HIS A 234 ? ? -153.49 21.08 322 12 ASN A 240 ? ? -41.16 -80.05 323 12 ALA A 242 ? ? 165.03 81.59 324 12 LYS A 243 ? ? 50.88 94.38 325 12 ASN A 244 ? ? -142.88 -5.61 326 12 PRO A 269 ? ? -46.87 -8.55 327 12 GLN A 271 ? ? -113.25 -165.42 328 12 SER A 280 ? ? -90.85 35.16 329 12 TRP A 281 ? ? -177.04 -169.62 330 12 PRO A 283 ? ? -49.31 174.86 331 12 SER A 286 ? ? -53.30 -81.84 332 12 CYS A 289 ? ? -98.24 -70.90 333 12 PRO A 317 ? ? -47.94 -17.77 334 12 GLN A 352 ? ? 71.13 70.48 335 12 PRO A 358 ? ? -80.51 42.73 336 12 TRP A 359 ? ? 28.80 -85.49 337 12 ASP A 360 ? ? 161.32 -17.89 338 12 GLN A 378 ? ? -146.09 13.53 339 13 LEU A 189 ? ? 54.59 -164.89 340 13 ARG A 190 ? ? 58.73 145.04 341 13 LEU A 192 ? ? 48.74 103.57 342 13 ASN A 204 ? ? 56.33 159.00 343 13 ASP A 205 ? ? -171.89 66.59 344 13 ARG A 210 ? ? -55.98 171.38 345 13 ARG A 211 ? ? -104.36 -123.54 346 13 HIS A 234 ? ? -149.01 14.08 347 13 ALA A 242 ? ? -170.42 83.21 348 13 LYS A 243 ? ? 54.61 92.78 349 13 ASN A 244 ? ? -149.58 -33.85 350 13 GLN A 266 ? ? 39.77 53.76 351 13 PRO A 269 ? ? -46.93 -8.57 352 13 GLN A 271 ? ? -121.18 -156.16 353 13 SER A 280 ? ? -103.90 45.77 354 13 TRP A 281 ? ? 165.83 119.79 355 13 SER A 282 ? ? -35.47 155.09 356 13 PRO A 283 ? ? -49.21 155.77 357 13 CYS A 284 ? ? -63.29 -114.18 358 13 SER A 286 ? ? -29.01 -79.65 359 13 TRP A 287 ? ? -37.00 -24.09 360 13 TYR A 313 ? ? -69.83 63.56 361 13 ASP A 314 ? ? -43.31 -18.39 362 13 PRO A 317 ? ? -51.09 -5.92 363 13 TRP A 359 ? ? 41.12 12.68 364 13 ASP A 360 ? ? 45.96 10.47 365 13 GLN A 380 ? ? 61.24 146.37 366 14 LEU A 192 ? ? 55.21 114.77 367 14 PHE A 202 ? ? -59.26 -6.00 368 14 ASN A 204 ? ? 48.04 74.50 369 14 LEU A 209 ? ? 55.17 -166.40 370 14 ARG A 210 ? ? -121.52 -151.58 371 14 LEU A 223 ? ? -67.02 99.29 372 14 HIS A 234 ? ? -151.83 16.08 373 14 CYS A 239 ? ? -105.88 -165.84 374 14 ASN A 240 ? ? -78.87 -78.97 375 14 ALA A 242 ? ? -154.32 82.97 376 14 ASN A 244 ? ? -141.68 24.67 377 14 LEU A 246 ? ? -47.96 -15.23 378 14 LEU A 267 ? ? -51.84 -179.49 379 14 PRO A 269 ? ? -48.08 -8.15 380 14 SER A 280 ? ? -99.59 41.29 381 14 TRP A 281 ? ? 162.72 118.39 382 14 SER A 282 ? ? -39.40 160.73 383 14 SER A 286 ? ? -55.38 -80.32 384 14 TRP A 287 ? ? -37.52 -26.03 385 14 CYS A 289 ? ? -98.87 -65.93 386 14 TYR A 313 ? ? -60.35 79.65 387 14 TYR A 315 ? ? -66.25 6.15 388 14 PRO A 317 ? ? -78.02 33.65 389 14 PRO A 355 ? ? -44.84 158.44 390 14 PRO A 358 ? ? -85.63 -79.03 391 14 TRP A 359 ? ? -173.26 7.07 392 14 ASP A 360 ? ? 69.44 -47.56 393 14 LEU A 377 ? ? -68.28 7.75 394 14 GLN A 380 ? ? -150.86 -24.68 395 15 MET A 193 ? ? -48.12 158.33 396 15 ASN A 204 ? ? -146.16 -24.30 397 15 ASP A 205 ? ? 174.41 157.56 398 15 LEU A 207 ? ? -172.41 146.47 399 15 ARG A 210 ? ? -43.87 152.55 400 15 ARG A 211 ? ? -163.34 -37.28 401 15 ARG A 212 ? ? -174.36 -36.01 402 15 GLN A 213 ? ? -59.40 82.45 403 15 ASN A 240 ? ? -54.23 -79.37 404 15 ALA A 242 ? ? -162.22 112.30 405 15 GLN A 266 ? ? 36.37 53.86 406 15 ALA A 270 ? ? -91.71 -63.84 407 15 ARG A 274 ? ? -160.17 107.84 408 15 SER A 280 ? ? -95.87 33.55 409 15 TRP A 281 ? ? 162.89 120.74 410 15 SER A 282 ? ? -37.51 159.84 411 15 CYS A 284 ? ? -78.78 -153.77 412 15 SER A 286 ? ? -60.94 -72.45 413 15 TRP A 287 ? ? -37.26 -25.88 414 15 CYS A 289 ? ? -99.05 -72.11 415 15 ASP A 314 ? ? -45.97 -13.16 416 15 TYR A 315 ? ? -60.93 0.71 417 15 PRO A 317 ? ? -51.32 -6.57 418 15 MET A 336 ? ? -42.43 157.77 419 15 ARG A 351 ? ? -169.31 47.36 420 15 GLN A 352 ? ? 70.27 33.90 421 15 PRO A 355 ? ? -44.58 158.48 422 15 PRO A 358 ? ? -82.94 30.86 423 15 TRP A 359 ? ? 34.24 -88.00 424 15 ASP A 360 ? ? -172.67 -29.90 425 15 LEU A 377 ? ? -58.43 -3.99 426 16 GLU A 187 ? ? 52.96 170.77 427 16 LEU A 189 ? ? -91.77 36.31 428 16 ARG A 190 ? ? 58.03 145.81 429 16 TYR A 191 ? ? -139.99 -46.08 430 16 LEU A 192 ? ? 46.01 100.11 431 16 MET A 193 ? ? -47.08 161.80 432 16 ASN A 204 ? ? 60.31 127.06 433 16 PRO A 206 ? ? -80.97 30.15 434 16 VAL A 208 ? ? 54.35 -108.89 435 16 LEU A 223 ? ? -62.68 95.83 436 16 HIS A 234 ? ? -151.77 19.59 437 16 LEU A 245 ? ? -46.45 -19.11 438 16 ALA A 270 ? ? -84.49 -71.15 439 16 GLN A 271 ? ? -64.38 -177.66 440 16 SER A 280 ? ? -87.61 39.66 441 16 TRP A 281 ? ? 175.35 -159.98 442 16 SER A 286 ? ? -51.06 -74.73 443 16 TRP A 287 ? ? -34.94 -27.45 444 16 CYS A 289 ? ? -97.76 -70.66 445 16 PRO A 317 ? ? -49.84 -13.17 446 16 TRP A 359 ? ? 37.16 -88.51 447 16 ASP A 360 ? ? -171.07 -29.78 448 17 GLU A 187 ? ? -51.14 174.08 449 17 ILE A 188 ? ? 54.37 159.46 450 17 ARG A 190 ? ? -117.34 -150.89 451 17 TYR A 191 ? ? -170.98 -48.56 452 17 LEU A 192 ? ? 38.25 92.58 453 17 ASN A 204 ? ? -172.84 32.11 454 17 PRO A 206 ? ? -49.03 -19.83 455 17 ARG A 211 ? ? -62.51 0.56 456 17 LEU A 223 ? ? -62.59 97.11 457 17 LYS A 243 ? ? -136.36 -105.22 458 17 GLN A 266 ? ? 38.93 54.21 459 17 ALA A 270 ? ? -63.54 -96.29 460 17 TRP A 281 ? ? 160.18 119.76 461 17 SER A 282 ? ? -37.52 160.69 462 17 CYS A 284 ? ? -65.32 -71.42 463 17 SER A 286 ? ? -49.03 -77.65 464 17 CYS A 289 ? ? -98.82 -61.79 465 17 ARG A 311 ? ? -172.53 121.85 466 17 ASP A 314 ? ? -43.74 -16.06 467 17 TYR A 315 ? ? -64.07 4.86 468 17 PRO A 317 ? ? -48.35 -18.05 469 17 MET A 336 ? ? -43.55 152.81 470 17 GLN A 352 ? ? 68.30 69.92 471 17 PRO A 358 ? ? -83.21 39.41 472 17 TRP A 359 ? ? 30.80 -89.47 473 17 ASP A 360 ? ? 169.03 -21.72 474 17 GLN A 378 ? ? -133.85 -56.35 475 18 ARG A 190 ? ? 58.69 143.74 476 18 LEU A 192 ? ? 49.34 102.76 477 18 LEU A 209 ? ? 63.30 117.74 478 18 ARG A 210 ? ? -142.71 -75.19 479 18 GLN A 213 ? ? -41.93 102.57 480 18 LEU A 265 ? ? -66.85 4.94 481 18 GLN A 266 ? ? 38.98 54.42 482 18 LEU A 267 ? ? -64.00 -166.99 483 18 ASP A 268 ? ? -158.94 85.46 484 18 PRO A 269 ? ? -49.09 -6.47 485 18 GLN A 271 ? ? -133.43 -156.52 486 18 ARG A 274 ? ? -160.90 113.31 487 18 SER A 280 ? ? -88.85 43.36 488 18 TRP A 281 ? ? 173.58 -167.76 489 18 PRO A 283 ? ? -48.66 160.33 490 18 CYS A 284 ? ? -73.79 -165.94 491 18 PHE A 285 ? ? -49.10 176.57 492 18 SER A 286 ? ? -80.13 -73.55 493 18 TRP A 287 ? ? -39.12 -24.28 494 18 CYS A 289 ? ? -98.45 -70.87 495 18 PRO A 317 ? ? -47.47 -9.81 496 18 GLN A 352 ? ? 70.97 35.68 497 18 PRO A 358 ? ? -82.22 35.68 498 18 TRP A 359 ? ? 35.67 -90.89 499 18 ASP A 360 ? ? 168.53 -23.84 500 19 GLU A 187 ? ? 56.61 115.84 501 19 LEU A 189 ? ? 56.22 -173.27 502 19 ARG A 190 ? ? -40.89 165.11 503 19 TYR A 191 ? ? -123.48 -142.99 504 19 ASN A 203 ? ? -51.55 -9.88 505 19 ASN A 204 ? ? 55.29 -100.28 506 19 ASP A 205 ? ? 56.39 159.66 507 19 LEU A 207 ? ? 51.14 178.69 508 19 ARG A 210 ? ? 42.20 90.49 509 19 ARG A 211 ? ? -41.97 94.17 510 19 LEU A 223 ? ? -64.28 98.58 511 19 HIS A 234 ? ? -147.14 17.82 512 19 ALA A 242 ? ? -99.22 -145.55 513 19 LEU A 267 ? ? -54.24 176.19 514 19 GLN A 271 ? ? -119.06 -156.98 515 19 SER A 280 ? ? -91.83 41.94 516 19 TRP A 281 ? ? 170.18 -173.89 517 19 PRO A 283 ? ? -48.80 168.02 518 19 CYS A 284 ? ? -59.30 -147.08 519 19 SER A 286 ? ? -39.14 -71.02 520 19 TRP A 287 ? ? -43.25 -17.76 521 19 PRO A 317 ? ? -78.84 29.47 522 19 ARG A 351 ? ? -154.97 79.61 523 19 PRO A 355 ? ? -47.28 172.44 524 19 GLN A 357 ? ? -39.89 102.23 525 19 PRO A 358 ? ? -84.93 43.45 526 19 TRP A 359 ? ? 31.55 -85.39 527 19 ASP A 360 ? ? 158.69 -17.34 528 19 GLN A 378 ? ? -146.28 38.71 529 19 ASN A 379 ? ? -50.28 94.13 530 19 GLN A 380 ? ? -146.05 -67.77 531 20 GLU A 187 ? ? 61.69 150.40 532 20 LEU A 189 ? ? -117.48 -161.49 533 20 ARG A 190 ? ? -98.14 -146.00 534 20 TYR A 191 ? ? -150.15 -38.29 535 20 LEU A 192 ? ? 54.45 108.52 536 20 ASN A 204 ? ? -101.20 73.48 537 20 ARG A 210 ? ? -58.58 178.48 538 20 ARG A 211 ? ? -42.39 101.37 539 20 ARG A 212 ? ? -175.40 -62.55 540 20 LEU A 223 ? ? -61.68 97.36 541 20 CYS A 239 ? ? -113.11 -161.95 542 20 ASN A 240 ? ? -81.73 -79.99 543 20 ALA A 242 ? ? -171.97 30.25 544 20 LYS A 243 ? ? -135.55 -82.41 545 20 LEU A 246 ? ? -48.12 -14.05 546 20 GLN A 266 ? ? 38.70 54.22 547 20 LEU A 267 ? ? -56.33 -171.77 548 20 ALA A 270 ? ? -81.26 -73.69 549 20 GLN A 271 ? ? -64.52 -170.72 550 20 ARG A 274 ? ? -165.46 116.91 551 20 SER A 280 ? ? -102.53 42.77 552 20 TRP A 281 ? ? 162.13 110.58 553 20 SER A 282 ? ? -39.28 157.15 554 20 SER A 286 ? ? -74.30 -78.05 555 20 TRP A 287 ? ? -39.91 -23.19 556 20 CYS A 289 ? ? -99.29 -71.43 557 20 ASP A 314 ? ? -49.40 -6.63 558 20 ASP A 316 ? ? -158.93 84.48 559 20 PRO A 317 ? ? -73.90 37.88 560 20 ARG A 351 ? ? -171.30 82.25 561 20 GLN A 352 ? ? 46.24 26.24 562 20 TRP A 359 ? ? 42.39 11.08 563 20 ASP A 360 ? ? 48.83 5.62 564 20 LEU A 377 ? ? -66.62 5.51 565 20 GLN A 378 ? ? -136.62 -31.55 566 20 ASN A 379 ? ? 49.81 20.11 567 20 GLN A 380 ? ? 41.80 -161.24 568 21 TYR A 191 ? ? -150.78 -141.26 569 21 ASP A 205 ? ? 57.64 76.05 570 21 VAL A 208 ? ? -54.01 -169.53 571 21 LEU A 209 ? ? 54.64 -82.74 572 21 ARG A 212 ? ? -41.82 -73.89 573 21 GLN A 213 ? ? -61.21 82.52 574 21 THR A 214 ? ? -111.00 -164.77 575 21 LEU A 223 ? ? -64.39 99.99 576 21 GLN A 233 ? ? -66.82 6.63 577 21 HIS A 234 ? ? -145.41 24.58 578 21 ASN A 240 ? ? -41.60 -80.00 579 21 GLU A 241 ? ? -69.73 99.06 580 21 ALA A 242 ? ? -160.54 94.37 581 21 LYS A 243 ? ? 50.14 80.55 582 21 ASN A 244 ? ? -165.52 -7.53 583 21 GLN A 266 ? ? 38.41 53.82 584 21 PRO A 269 ? ? -47.38 -8.34 585 21 GLN A 271 ? ? -113.22 -156.48 586 21 SER A 280 ? ? -84.55 30.68 587 21 TRP A 281 ? ? -172.82 -156.27 588 21 CYS A 284 ? ? -88.06 -158.35 589 21 PHE A 285 ? ? -49.09 173.89 590 21 SER A 286 ? ? -67.90 -74.30 591 21 CYS A 289 ? ? -98.76 -70.88 592 21 ASP A 314 ? ? -51.85 3.10 593 21 TYR A 315 ? ? -60.41 0.03 594 21 LEU A 318 ? ? -39.90 -22.75 595 21 VAL A 349 ? ? -153.48 89.41 596 21 PRO A 355 ? ? -45.32 172.40 597 21 PRO A 358 ? ? -78.89 -77.11 598 21 TRP A 359 ? ? -161.03 -59.83 599 21 ASP A 360 ? ? 163.96 -36.01 600 21 LEU A 377 ? ? -69.20 7.80 601 21 GLN A 378 ? ? -145.07 34.05 602 21 ASN A 379 ? ? -38.63 105.01 603 22 ARG A 190 ? ? -118.44 -165.60 604 22 TYR A 191 ? ? -138.73 -31.65 605 22 LEU A 192 ? ? 54.13 87.69 606 22 MET A 193 ? ? -48.55 152.22 607 22 ASN A 203 ? ? -48.71 -14.71 608 22 ASN A 204 ? ? 65.80 -5.50 609 22 PRO A 206 ? ? -62.77 -82.39 610 22 LEU A 207 ? ? 72.84 -50.89 611 22 LEU A 209 ? ? -59.61 -165.15 612 22 LEU A 223 ? ? -61.58 96.00 613 22 ASN A 240 ? ? -88.31 -80.01 614 22 ALA A 242 ? ? -168.20 85.50 615 22 LEU A 267 ? ? -55.53 177.00 616 22 GLN A 271 ? ? -108.00 -156.55 617 22 ARG A 274 ? ? -161.23 114.21 618 22 TRP A 281 ? ? -163.44 -154.89 619 22 SER A 286 ? ? -42.47 -77.56 620 22 TRP A 287 ? ? -36.82 -26.28 621 22 CYS A 289 ? ? -98.96 -67.48 622 22 GLN A 352 ? ? 71.61 47.57 623 22 PRO A 358 ? ? -83.08 -80.18 624 22 TRP A 359 ? ? -162.03 -63.77 625 22 ASP A 360 ? ? 159.37 -62.27 626 22 GLN A 380 ? ? -136.18 -79.99 627 23 GLU A 187 ? ? 61.41 145.82 628 23 ARG A 190 ? ? -93.61 -145.57 629 23 TYR A 191 ? ? -163.87 -42.94 630 23 LEU A 192 ? ? 58.35 125.33 631 23 ASP A 205 ? ? -163.92 69.89 632 23 PRO A 206 ? ? -53.78 -159.67 633 23 VAL A 208 ? ? 54.20 -83.87 634 23 LEU A 209 ? ? -174.85 129.53 635 23 ARG A 212 ? ? -145.92 -30.71 636 23 GLN A 213 ? ? -47.31 172.90 637 23 LEU A 223 ? ? -67.34 99.33 638 23 HIS A 234 ? ? -152.64 20.71 639 23 CYS A 239 ? ? -98.10 -151.68 640 23 GLN A 266 ? ? 37.96 54.64 641 23 SER A 280 ? ? -77.66 20.78 642 23 TRP A 281 ? ? -162.06 -141.07 643 23 CYS A 284 ? ? -72.48 -86.62 644 23 TRP A 287 ? ? -44.02 -15.31 645 23 ASP A 316 ? ? -176.05 92.56 646 23 PRO A 317 ? ? -79.76 28.21 647 23 PRO A 355 ? ? -51.44 171.13 648 23 PRO A 358 ? ? -82.71 34.34 649 23 TRP A 359 ? ? 27.85 -89.72 650 23 ASP A 360 ? ? 168.22 -22.26 651 23 LEU A 377 ? ? -69.26 7.75 652 23 GLN A 378 ? ? -142.01 39.61 653 23 GLN A 380 ? ? -144.56 -12.77 654 24 ARG A 190 ? ? -141.98 -147.83 655 24 TYR A 191 ? ? -154.17 -42.77 656 24 LEU A 192 ? ? 45.27 97.60 657 24 MET A 193 ? ? -41.86 156.70 658 24 ASN A 204 ? ? -42.55 93.03 659 24 PRO A 206 ? ? -37.91 95.66 660 24 LEU A 209 ? ? 48.70 96.62 661 24 ARG A 211 ? ? -41.21 158.05 662 24 GLN A 213 ? ? -60.16 82.35 663 24 THR A 214 ? ? -103.92 -156.84 664 24 HIS A 234 ? ? -145.96 48.12 665 24 ASN A 240 ? ? -47.16 -79.44 666 24 ALA A 242 ? ? -163.48 44.95 667 24 LYS A 243 ? ? 54.05 102.27 668 24 ASN A 244 ? ? -144.10 -0.11 669 24 GLN A 266 ? ? 39.18 54.60 670 24 LEU A 267 ? ? -54.62 -165.25 671 24 PRO A 269 ? ? -47.96 -7.63 672 24 GLN A 271 ? ? -129.35 -156.56 673 24 SER A 280 ? ? -94.27 37.99 674 24 TRP A 281 ? ? -177.77 -166.55 675 24 PRO A 283 ? ? -49.46 174.88 676 24 SER A 286 ? ? -66.47 -73.16 677 24 TRP A 287 ? ? -38.88 -25.57 678 24 CYS A 289 ? ? -99.66 -62.89 679 24 ALA A 290 ? ? -39.88 -34.22 680 24 PRO A 317 ? ? -45.95 -10.93 681 24 ARG A 351 ? ? -162.78 23.92 682 24 PRO A 358 ? ? -82.45 -79.74 683 24 TRP A 359 ? ? -163.39 -61.47 684 24 ASP A 360 ? ? 158.06 -64.66 685 24 LEU A 377 ? ? -69.48 7.56 686 24 GLN A 378 ? ? -140.36 12.99 687 25 ARG A 190 ? ? -104.79 -155.04 688 25 TYR A 191 ? ? -176.16 127.74 689 25 MET A 193 ? ? -48.36 178.98 690 25 ASN A 204 ? ? 42.09 93.84 691 25 ASP A 205 ? ? 179.19 -49.52 692 25 THR A 214 ? ? -115.49 -161.36 693 25 LEU A 223 ? ? -59.42 100.58 694 25 ASN A 240 ? ? -39.72 -70.39 695 25 ALA A 242 ? ? -141.26 33.05 696 25 GLN A 266 ? ? 39.72 54.55 697 25 ALA A 270 ? ? -92.97 -65.17 698 25 SER A 280 ? ? -89.59 37.69 699 25 TRP A 281 ? ? 176.36 -159.48 700 25 CYS A 284 ? ? -68.30 -144.84 701 25 SER A 286 ? ? -35.40 -79.00 702 25 TRP A 287 ? ? -39.43 -23.16 703 25 CYS A 289 ? ? -99.69 -60.99 704 25 TYR A 313 ? ? -51.13 101.48 705 25 ASP A 316 ? ? -150.42 67.71 706 25 ARG A 351 ? ? -152.27 9.36 707 25 TRP A 359 ? ? 41.59 10.49 708 25 ASP A 360 ? ? 47.21 9.65 709 25 LEU A 377 ? ? -68.57 7.99 710 25 GLN A 380 ? ? -142.73 -6.28 711 26 GLU A 187 ? ? -51.98 177.27 712 26 LEU A 189 ? ? 68.41 169.24 713 26 ARG A 190 ? ? 58.75 143.62 714 26 TYR A 191 ? ? -137.99 -43.39 715 26 LEU A 192 ? ? 45.37 99.53 716 26 ASN A 204 ? ? 66.29 175.49 717 26 ASP A 205 ? ? 178.06 -49.33 718 26 VAL A 208 ? ? -90.00 -121.77 719 26 LEU A 209 ? ? -103.84 -68.49 720 26 ARG A 211 ? ? 50.20 98.65 721 26 LEU A 223 ? ? -65.68 97.83 722 26 ASN A 240 ? ? -45.97 -79.21 723 26 ALA A 242 ? ? -171.39 87.17 724 26 LYS A 243 ? ? 47.53 96.55 725 26 ASN A 244 ? ? -159.50 -23.24 726 26 PRO A 269 ? ? -47.26 -8.55 727 26 GLN A 271 ? ? -129.68 -156.48 728 26 ARG A 274 ? ? -164.78 115.48 729 26 SER A 280 ? ? -104.46 40.33 730 26 TRP A 281 ? ? 165.05 117.15 731 26 SER A 282 ? ? -35.02 155.48 732 26 PHE A 285 ? ? -51.83 176.48 733 26 SER A 286 ? ? -70.38 -71.89 734 26 CYS A 289 ? ? -98.58 -70.93 735 26 TYR A 313 ? ? -69.95 67.65 736 26 ASP A 314 ? ? -43.53 -15.79 737 26 PRO A 317 ? ? -47.96 -8.16 738 26 MET A 336 ? ? -41.81 155.17 739 26 ARG A 351 ? ? -174.35 88.14 740 26 GLN A 352 ? ? 47.78 21.31 741 26 TRP A 359 ? ? 40.52 12.89 742 26 ASP A 360 ? ? 47.15 10.19 743 26 LEU A 377 ? ? -67.25 7.53 744 26 ASN A 379 ? ? -48.30 156.23 745 27 LEU A 189 ? ? -61.78 99.02 746 27 ARG A 190 ? ? 58.34 148.93 747 27 LEU A 192 ? ? -42.16 90.51 748 27 VAL A 208 ? ? -140.09 -36.07 749 27 LEU A 209 ? ? 55.04 -82.02 750 27 ARG A 210 ? ? -138.00 -72.30 751 27 ARG A 211 ? ? -86.36 -152.69 752 27 ARG A 212 ? ? 63.79 -70.71 753 27 LEU A 223 ? ? -66.65 99.08 754 27 ASN A 240 ? ? -75.97 -80.02 755 27 LYS A 243 ? ? 66.18 145.92 756 27 ASN A 244 ? ? -156.72 73.33 757 27 PRO A 269 ? ? -46.91 -8.51 758 27 GLN A 271 ? ? -126.39 -156.56 759 27 SER A 280 ? ? -93.44 30.38 760 27 TRP A 281 ? ? 163.24 127.15 761 27 SER A 282 ? ? -40.91 166.18 762 27 PRO A 283 ? ? -49.23 169.97 763 27 SER A 286 ? ? -65.97 -80.85 764 27 TRP A 287 ? ? -47.74 -13.86 765 27 CYS A 289 ? ? -98.27 -70.91 766 27 ASP A 314 ? ? -43.54 -19.37 767 27 TRP A 359 ? ? 36.35 18.79 768 27 ASP A 360 ? ? 63.97 -19.73 769 28 ILE A 188 ? ? 54.46 159.98 770 28 LEU A 189 ? ? -67.59 -158.79 771 28 LEU A 192 ? ? 54.51 111.56 772 28 ASN A 203 ? ? -49.21 -12.18 773 28 ASN A 204 ? ? 58.86 88.39 774 28 PRO A 206 ? ? -68.66 81.15 775 28 LEU A 207 ? ? 43.32 76.47 776 28 LEU A 209 ? ? 59.73 15.48 777 28 ARG A 211 ? ? 53.77 -162.93 778 28 GLN A 213 ? ? -45.77 172.43 779 28 ASN A 225 ? ? 70.24 30.77 780 28 HIS A 234 ? ? -150.96 18.87 781 28 GLU A 241 ? ? -58.19 105.90 782 28 ASN A 244 ? ? 46.50 87.62 783 28 HIS A 253 ? ? -47.79 99.04 784 28 GLN A 271 ? ? -125.84 -160.38 785 28 SER A 280 ? ? -90.08 43.77 786 28 TRP A 281 ? ? 170.67 -168.19 787 28 CYS A 284 ? ? -87.03 -158.06 788 28 PHE A 285 ? ? -57.67 173.45 789 28 TRP A 287 ? ? -38.56 -23.49 790 28 CYS A 289 ? ? -98.27 -71.31 791 28 TYR A 313 ? ? -56.77 97.66 792 28 ARG A 351 ? ? -171.32 -59.56 793 28 GLN A 352 ? ? 65.84 69.30 794 28 GLN A 357 ? ? -37.39 97.50 795 28 PRO A 358 ? ? -86.54 46.96 796 28 TRP A 359 ? ? -32.91 158.65 797 28 GLN A 378 ? ? -133.87 -30.20 798 28 ASN A 379 ? ? -55.06 82.63 799 28 GLN A 380 ? ? -104.95 -142.27 800 29 GLU A 187 ? ? 54.22 167.33 801 29 LEU A 189 ? ? -163.88 -169.74 802 29 ARG A 190 ? ? -143.73 -151.90 803 29 TYR A 191 ? ? -170.26 -42.39 804 29 LEU A 192 ? ? 40.89 96.70 805 29 PHE A 202 ? ? -56.57 -6.33 806 29 ASN A 204 ? ? 42.14 72.89 807 29 PRO A 206 ? ? -58.33 100.24 808 29 ARG A 212 ? ? -40.78 -74.27 809 29 ASN A 240 ? ? -92.50 -80.72 810 29 ALA A 242 ? ? -170.53 -146.70 811 29 LEU A 246 ? ? -53.17 -8.44 812 29 ALA A 270 ? ? -92.35 -70.41 813 29 SER A 280 ? ? -103.38 41.21 814 29 TRP A 281 ? ? 161.58 118.22 815 29 SER A 282 ? ? -37.24 158.50 816 29 CYS A 284 ? ? -57.20 -98.98 817 29 ASP A 314 ? ? -55.21 -2.00 818 29 GLN A 352 ? ? 71.08 52.11 819 29 PRO A 355 ? ? -48.64 172.47 820 29 GLN A 357 ? ? -38.40 100.04 821 29 TRP A 359 ? ? 45.91 9.52 822 29 ASP A 360 ? ? 63.13 -56.64 823 29 LEU A 377 ? ? -62.34 0.85 824 29 GLN A 378 ? ? -136.50 -88.28 825 29 ASN A 379 ? ? 39.45 -161.28 826 30 ARG A 190 ? ? -102.09 -168.86 827 30 TYR A 191 ? ? -74.79 -125.60 828 30 MET A 193 ? ? -44.00 161.61 829 30 ASN A 204 ? ? 59.30 100.70 830 30 LEU A 207 ? ? 61.62 -71.72 831 30 VAL A 208 ? ? -73.09 -163.62 832 30 LEU A 209 ? ? 56.94 9.19 833 30 ARG A 210 ? ? 51.31 15.19 834 30 ARG A 212 ? ? -46.62 -17.17 835 30 LEU A 223 ? ? -63.14 93.08 836 30 ASN A 240 ? ? -93.22 -64.63 837 30 ALA A 242 ? ? -151.95 38.60 838 30 LYS A 243 ? ? 45.17 23.58 839 30 LEU A 267 ? ? -52.41 174.65 840 30 ALA A 270 ? ? -62.42 -98.77 841 30 TRP A 281 ? ? -175.74 -165.83 842 30 PHE A 285 ? ? -52.09 176.70 843 30 CYS A 289 ? ? -99.11 -71.41 844 30 ARG A 351 ? ? -158.37 24.80 845 30 PRO A 358 ? ? -82.38 42.20 846 30 TRP A 359 ? ? 32.07 -86.90 847 30 ASP A 360 ? ? 163.30 -20.65 848 30 LEU A 377 ? ? -67.61 5.71 849 30 GLN A 380 ? ? 74.15 148.08 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 383 ? A LEU 198 2 1 Y 1 A GLU 384 ? A GLU 199 3 1 Y 1 A HIS 385 ? A HIS 200 4 1 Y 1 A HIS 386 ? A HIS 201 5 1 Y 1 A HIS 387 ? A HIS 202 6 1 Y 1 A HIS 388 ? A HIS 203 7 1 Y 1 A HIS 389 ? A HIS 204 8 1 Y 1 A HIS 390 ? A HIS 205 9 2 Y 1 A LEU 383 ? A LEU 198 10 2 Y 1 A GLU 384 ? A GLU 199 11 2 Y 1 A HIS 385 ? A HIS 200 12 2 Y 1 A HIS 386 ? A HIS 201 13 2 Y 1 A HIS 387 ? A HIS 202 14 2 Y 1 A HIS 388 ? A HIS 203 15 2 Y 1 A HIS 389 ? A HIS 204 16 2 Y 1 A HIS 390 ? A HIS 205 17 3 Y 1 A LEU 383 ? A LEU 198 18 3 Y 1 A GLU 384 ? A GLU 199 19 3 Y 1 A HIS 385 ? A HIS 200 20 3 Y 1 A HIS 386 ? A HIS 201 21 3 Y 1 A HIS 387 ? A HIS 202 22 3 Y 1 A HIS 388 ? A HIS 203 23 3 Y 1 A HIS 389 ? A HIS 204 24 3 Y 1 A HIS 390 ? A HIS 205 25 4 Y 1 A LEU 383 ? A LEU 198 26 4 Y 1 A GLU 384 ? A GLU 199 27 4 Y 1 A HIS 385 ? A HIS 200 28 4 Y 1 A HIS 386 ? A HIS 201 29 4 Y 1 A HIS 387 ? A HIS 202 30 4 Y 1 A HIS 388 ? A HIS 203 31 4 Y 1 A HIS 389 ? A HIS 204 32 4 Y 1 A HIS 390 ? A HIS 205 33 5 Y 1 A LEU 383 ? A LEU 198 34 5 Y 1 A GLU 384 ? A GLU 199 35 5 Y 1 A HIS 385 ? A HIS 200 36 5 Y 1 A HIS 386 ? A HIS 201 37 5 Y 1 A HIS 387 ? A HIS 202 38 5 Y 1 A HIS 388 ? A HIS 203 39 5 Y 1 A HIS 389 ? A HIS 204 40 5 Y 1 A HIS 390 ? A HIS 205 41 6 Y 1 A LEU 383 ? A LEU 198 42 6 Y 1 A GLU 384 ? A GLU 199 43 6 Y 1 A HIS 385 ? A HIS 200 44 6 Y 1 A HIS 386 ? A HIS 201 45 6 Y 1 A HIS 387 ? A HIS 202 46 6 Y 1 A HIS 388 ? A HIS 203 47 6 Y 1 A HIS 389 ? A HIS 204 48 6 Y 1 A HIS 390 ? A HIS 205 49 7 Y 1 A LEU 383 ? A LEU 198 50 7 Y 1 A GLU 384 ? A GLU 199 51 7 Y 1 A HIS 385 ? A HIS 200 52 7 Y 1 A HIS 386 ? A HIS 201 53 7 Y 1 A HIS 387 ? A HIS 202 54 7 Y 1 A HIS 388 ? A HIS 203 55 7 Y 1 A HIS 389 ? A HIS 204 56 7 Y 1 A HIS 390 ? A HIS 205 57 8 Y 1 A LEU 383 ? A LEU 198 58 8 Y 1 A GLU 384 ? A GLU 199 59 8 Y 1 A HIS 385 ? A HIS 200 60 8 Y 1 A HIS 386 ? A HIS 201 61 8 Y 1 A HIS 387 ? A HIS 202 62 8 Y 1 A HIS 388 ? A HIS 203 63 8 Y 1 A HIS 389 ? A HIS 204 64 8 Y 1 A HIS 390 ? A HIS 205 65 9 Y 1 A LEU 383 ? A LEU 198 66 9 Y 1 A GLU 384 ? A GLU 199 67 9 Y 1 A HIS 385 ? A HIS 200 68 9 Y 1 A HIS 386 ? A HIS 201 69 9 Y 1 A HIS 387 ? A HIS 202 70 9 Y 1 A HIS 388 ? A HIS 203 71 9 Y 1 A HIS 389 ? A HIS 204 72 9 Y 1 A HIS 390 ? A HIS 205 73 10 Y 1 A LEU 383 ? A LEU 198 74 10 Y 1 A GLU 384 ? A GLU 199 75 10 Y 1 A HIS 385 ? A HIS 200 76 10 Y 1 A HIS 386 ? A HIS 201 77 10 Y 1 A HIS 387 ? A HIS 202 78 10 Y 1 A HIS 388 ? A HIS 203 79 10 Y 1 A HIS 389 ? A HIS 204 80 10 Y 1 A HIS 390 ? A HIS 205 81 11 Y 1 A LEU 383 ? A LEU 198 82 11 Y 1 A GLU 384 ? A GLU 199 83 11 Y 1 A HIS 385 ? A HIS 200 84 11 Y 1 A HIS 386 ? A HIS 201 85 11 Y 1 A HIS 387 ? A HIS 202 86 11 Y 1 A HIS 388 ? A HIS 203 87 11 Y 1 A HIS 389 ? A HIS 204 88 11 Y 1 A HIS 390 ? A HIS 205 89 12 Y 1 A LEU 383 ? A LEU 198 90 12 Y 1 A GLU 384 ? A GLU 199 91 12 Y 1 A HIS 385 ? A HIS 200 92 12 Y 1 A HIS 386 ? A HIS 201 93 12 Y 1 A HIS 387 ? A HIS 202 94 12 Y 1 A HIS 388 ? A HIS 203 95 12 Y 1 A HIS 389 ? A HIS 204 96 12 Y 1 A HIS 390 ? A HIS 205 97 13 Y 1 A LEU 383 ? A LEU 198 98 13 Y 1 A GLU 384 ? A GLU 199 99 13 Y 1 A HIS 385 ? A HIS 200 100 13 Y 1 A HIS 386 ? A HIS 201 101 13 Y 1 A HIS 387 ? A HIS 202 102 13 Y 1 A HIS 388 ? A HIS 203 103 13 Y 1 A HIS 389 ? A HIS 204 104 13 Y 1 A HIS 390 ? A HIS 205 105 14 Y 1 A LEU 383 ? A LEU 198 106 14 Y 1 A GLU 384 ? A GLU 199 107 14 Y 1 A HIS 385 ? A HIS 200 108 14 Y 1 A HIS 386 ? A HIS 201 109 14 Y 1 A HIS 387 ? A HIS 202 110 14 Y 1 A HIS 388 ? A HIS 203 111 14 Y 1 A HIS 389 ? A HIS 204 112 14 Y 1 A HIS 390 ? A HIS 205 113 15 Y 1 A LEU 383 ? A LEU 198 114 15 Y 1 A GLU 384 ? A GLU 199 115 15 Y 1 A HIS 385 ? A HIS 200 116 15 Y 1 A HIS 386 ? A HIS 201 117 15 Y 1 A HIS 387 ? A HIS 202 118 15 Y 1 A HIS 388 ? A HIS 203 119 15 Y 1 A HIS 389 ? A HIS 204 120 15 Y 1 A HIS 390 ? A HIS 205 121 16 Y 1 A LEU 383 ? A LEU 198 122 16 Y 1 A GLU 384 ? A GLU 199 123 16 Y 1 A HIS 385 ? A HIS 200 124 16 Y 1 A HIS 386 ? A HIS 201 125 16 Y 1 A HIS 387 ? A HIS 202 126 16 Y 1 A HIS 388 ? A HIS 203 127 16 Y 1 A HIS 389 ? A HIS 204 128 16 Y 1 A HIS 390 ? A HIS 205 129 17 Y 1 A LEU 383 ? A LEU 198 130 17 Y 1 A GLU 384 ? A GLU 199 131 17 Y 1 A HIS 385 ? A HIS 200 132 17 Y 1 A HIS 386 ? A HIS 201 133 17 Y 1 A HIS 387 ? A HIS 202 134 17 Y 1 A HIS 388 ? A HIS 203 135 17 Y 1 A HIS 389 ? A HIS 204 136 17 Y 1 A HIS 390 ? A HIS 205 137 18 Y 1 A LEU 383 ? A LEU 198 138 18 Y 1 A GLU 384 ? A GLU 199 139 18 Y 1 A HIS 385 ? A HIS 200 140 18 Y 1 A HIS 386 ? A HIS 201 141 18 Y 1 A HIS 387 ? A HIS 202 142 18 Y 1 A HIS 388 ? A HIS 203 143 18 Y 1 A HIS 389 ? A HIS 204 144 18 Y 1 A HIS 390 ? A HIS 205 145 19 Y 1 A LEU 383 ? A LEU 198 146 19 Y 1 A GLU 384 ? A GLU 199 147 19 Y 1 A HIS 385 ? A HIS 200 148 19 Y 1 A HIS 386 ? A HIS 201 149 19 Y 1 A HIS 387 ? A HIS 202 150 19 Y 1 A HIS 388 ? A HIS 203 151 19 Y 1 A HIS 389 ? A HIS 204 152 19 Y 1 A HIS 390 ? A HIS 205 153 20 Y 1 A LEU 383 ? A LEU 198 154 20 Y 1 A GLU 384 ? A GLU 199 155 20 Y 1 A HIS 385 ? A HIS 200 156 20 Y 1 A HIS 386 ? A HIS 201 157 20 Y 1 A HIS 387 ? A HIS 202 158 20 Y 1 A HIS 388 ? A HIS 203 159 20 Y 1 A HIS 389 ? A HIS 204 160 20 Y 1 A HIS 390 ? A HIS 205 161 21 Y 1 A LEU 383 ? A LEU 198 162 21 Y 1 A GLU 384 ? A GLU 199 163 21 Y 1 A HIS 385 ? A HIS 200 164 21 Y 1 A HIS 386 ? A HIS 201 165 21 Y 1 A HIS 387 ? A HIS 202 166 21 Y 1 A HIS 388 ? A HIS 203 167 21 Y 1 A HIS 389 ? A HIS 204 168 21 Y 1 A HIS 390 ? A HIS 205 169 22 Y 1 A LEU 383 ? A LEU 198 170 22 Y 1 A GLU 384 ? A GLU 199 171 22 Y 1 A HIS 385 ? A HIS 200 172 22 Y 1 A HIS 386 ? A HIS 201 173 22 Y 1 A HIS 387 ? A HIS 202 174 22 Y 1 A HIS 388 ? A HIS 203 175 22 Y 1 A HIS 389 ? A HIS 204 176 22 Y 1 A HIS 390 ? A HIS 205 177 23 Y 1 A LEU 383 ? A LEU 198 178 23 Y 1 A GLU 384 ? A GLU 199 179 23 Y 1 A HIS 385 ? A HIS 200 180 23 Y 1 A HIS 386 ? A HIS 201 181 23 Y 1 A HIS 387 ? A HIS 202 182 23 Y 1 A HIS 388 ? A HIS 203 183 23 Y 1 A HIS 389 ? A HIS 204 184 23 Y 1 A HIS 390 ? A HIS 205 185 24 Y 1 A LEU 383 ? A LEU 198 186 24 Y 1 A GLU 384 ? A GLU 199 187 24 Y 1 A HIS 385 ? A HIS 200 188 24 Y 1 A HIS 386 ? A HIS 201 189 24 Y 1 A HIS 387 ? A HIS 202 190 24 Y 1 A HIS 388 ? A HIS 203 191 24 Y 1 A HIS 389 ? A HIS 204 192 24 Y 1 A HIS 390 ? A HIS 205 193 25 Y 1 A LEU 383 ? A LEU 198 194 25 Y 1 A GLU 384 ? A GLU 199 195 25 Y 1 A HIS 385 ? A HIS 200 196 25 Y 1 A HIS 386 ? A HIS 201 197 25 Y 1 A HIS 387 ? A HIS 202 198 25 Y 1 A HIS 388 ? A HIS 203 199 25 Y 1 A HIS 389 ? A HIS 204 200 25 Y 1 A HIS 390 ? A HIS 205 201 26 Y 1 A LEU 383 ? A LEU 198 202 26 Y 1 A GLU 384 ? A GLU 199 203 26 Y 1 A HIS 385 ? A HIS 200 204 26 Y 1 A HIS 386 ? A HIS 201 205 26 Y 1 A HIS 387 ? A HIS 202 206 26 Y 1 A HIS 388 ? A HIS 203 207 26 Y 1 A HIS 389 ? A HIS 204 208 26 Y 1 A HIS 390 ? A HIS 205 209 27 Y 1 A LEU 383 ? A LEU 198 210 27 Y 1 A GLU 384 ? A GLU 199 211 27 Y 1 A HIS 385 ? A HIS 200 212 27 Y 1 A HIS 386 ? A HIS 201 213 27 Y 1 A HIS 387 ? A HIS 202 214 27 Y 1 A HIS 388 ? A HIS 203 215 27 Y 1 A HIS 389 ? A HIS 204 216 27 Y 1 A HIS 390 ? A HIS 205 217 28 Y 1 A LEU 383 ? A LEU 198 218 28 Y 1 A GLU 384 ? A GLU 199 219 28 Y 1 A HIS 385 ? A HIS 200 220 28 Y 1 A HIS 386 ? A HIS 201 221 28 Y 1 A HIS 387 ? A HIS 202 222 28 Y 1 A HIS 388 ? A HIS 203 223 28 Y 1 A HIS 389 ? A HIS 204 224 28 Y 1 A HIS 390 ? A HIS 205 225 29 Y 1 A LEU 383 ? A LEU 198 226 29 Y 1 A GLU 384 ? A GLU 199 227 29 Y 1 A HIS 385 ? A HIS 200 228 29 Y 1 A HIS 386 ? A HIS 201 229 29 Y 1 A HIS 387 ? A HIS 202 230 29 Y 1 A HIS 388 ? A HIS 203 231 29 Y 1 A HIS 389 ? A HIS 204 232 29 Y 1 A HIS 390 ? A HIS 205 233 30 Y 1 A LEU 383 ? A LEU 198 234 30 Y 1 A GLU 384 ? A GLU 199 235 30 Y 1 A HIS 385 ? A HIS 200 236 30 Y 1 A HIS 386 ? A HIS 201 237 30 Y 1 A HIS 387 ? A HIS 202 238 30 Y 1 A HIS 388 ? A HIS 203 239 30 Y 1 A HIS 389 ? A HIS 204 240 30 Y 1 A HIS 390 ? A HIS 205 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #