data_2NCT # _entry.id 2NCT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104703 RCSB ? ? 2NCT PDB pdb_00002nct 10.2210/pdb2nct/pdb 26035 BMRB ? ? D_1000104703 WWPDB ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 26034 BMRB 'Chemical shifts for the same peptide in DPC micelles' unspecified 2NCS PDB 'Structure for the same peptide in DPC micelles' unspecified 26035 BMRB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2NCT _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2016-04-14 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Jimenez, M.' 1 'Nieva, J.L.' 2 'Rujas, E.' 3 'Partida-Hanon, A.' 4 'Bruix, M.' 5 # _citation.id primary _citation.title ;Structural basis for broad neutralization of HIV-1 through the molecular recognition of 10E8 helical epitope at the membrane interface. ; _citation.journal_abbrev 'Sci Rep' _citation.journal_volume 6 _citation.page_first 38177 _citation.page_last 38177 _citation.year 2016 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 2045-2322 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 27905530 _citation.pdbx_database_id_DOI 10.1038/srep38177 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rujas, E.' 1 ? primary 'Caaveiro, J.M.' 2 ? primary 'Partida-Hanon, A.' 3 ? primary 'Gulzar, N.' 4 ? primary 'Morante, K.' 5 ? primary 'Apellaniz, B.' 6 ? primary 'Garcia-Porras, M.' 7 ? primary 'Bruix, M.' 8 ? primary 'Tsumoto, K.' 9 ? primary 'Scott, J.K.' 10 ? primary 'Jimenez, M.A.' 11 ? primary 'Nieva, J.L.' 12 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'Envelope glycoprotein gp41' _entity.formula_weight 4624.687 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 95-121' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code KKKKDKWASLWNWFDITNWLWYIKLFIMIVGKKKKK _entity_poly.pdbx_seq_one_letter_code_can KKKKDKWASLWNWFDITNWLWYIKLFIMIVGKKKKK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 LYS n 1 3 LYS n 1 4 LYS n 1 5 ASP n 1 6 LYS n 1 7 TRP n 1 8 ALA n 1 9 SER n 1 10 LEU n 1 11 TRP n 1 12 ASN n 1 13 TRP n 1 14 PHE n 1 15 ASP n 1 16 ILE n 1 17 THR n 1 18 ASN n 1 19 TRP n 1 20 LEU n 1 21 TRP n 1 22 TYR n 1 23 ILE n 1 24 LYS n 1 25 LEU n 1 26 PHE n 1 27 ILE n 1 28 MET n 1 29 ILE n 1 30 VAL n 1 31 GLY n 1 32 LYS n 1 33 LYS n 1 34 LYS n 1 35 LYS n 1 36 LYS n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Human immunodeficiency virus 1' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 11676 _pdbx_entity_src_syn.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q66X49_9HIV1 _struct_ref.pdbx_db_accession Q66X49 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DKWASLWNWFDITNWLWYIKLFIMIVG _struct_ref.pdbx_align_begin 95 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2NCT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 31 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q66X49 _struct_ref_seq.db_align_beg 95 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 121 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 31 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2NCT LYS A 1 ? UNP Q66X49 ? ? insertion 1 1 1 2NCT LYS A 2 ? UNP Q66X49 ? ? insertion 2 2 1 2NCT LYS A 3 ? UNP Q66X49 ? ? insertion 3 3 1 2NCT LYS A 4 ? UNP Q66X49 ? ? insertion 4 4 1 2NCT LYS A 32 ? UNP Q66X49 ? ? insertion 32 5 1 2NCT LYS A 33 ? UNP Q66X49 ? ? insertion 33 6 1 2NCT LYS A 34 ? UNP Q66X49 ? ? insertion 34 7 1 2NCT LYS A 35 ? UNP Q66X49 ? ? insertion 35 8 1 2NCT LYS A 36 ? UNP Q66X49 ? ? insertion 36 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H TOCSY' 1 2 1 '2D 1H-1H NOESY' 2 3 2 '2D 1H-1H TOCSY' 2 4 2 '2D 1H-1H NOESY' 1 5 2 '2D 1H-13C HSQC aliphatic' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.temperature_units 1 2 7 ambient ? 308 K 2 2 7 ambient ? 298 K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.5 mM 10E8p, 25 % v/v [U-2H] HFIP, 2 mM HEPES, 0.1 mM DSS, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.5 mM 10E8p, 25 % v/v [U-2H] HFIP, 2 mM HEPES, 0.1 mM DSS, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker AVANCE 1 'Bruker Avance' 800 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2NCT _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2NCT _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2NCT _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Bruker Biospin' collection TopSpin 1 ? 'Bruker Biospin' processing TopSpin 2 ? Goddard 'chemical shift assignment' Sparky 3 ? 'Cornilescu, Delaglio and Bax' 'dihedral angle restraints' TALOS 4 ? 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 5 ? ? refinement CYANA 6 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2NCT _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2NCT _struct.title ;NMR assignment and structure of a peptide derived from the membrane proximal external region of HIV-1 gp41 in the presence of hexafluoroisopropanol ; _struct.pdbx_model_details 'fewest violations, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2NCT _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text 'neutralizing epitope, peptide vaccine, VIRAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 5 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 35 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 5 _struct_conf.end_auth_comp_id LYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 35 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 31 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2NCT _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 TRP 7 7 7 TRP TRP A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 TRP 11 11 11 TRP TRP A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 TRP 13 13 13 TRP TRP A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 TRP 19 19 19 TRP TRP A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 TRP 21 21 21 TRP TRP A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 MET 28 28 28 MET MET A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 LYS 36 36 36 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-02-22 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 2 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' 6 2 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.001 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.000 _pdbx_nmr_ensemble_rms.entry_id 2NCT _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 10E8p-1 0.5 ? mM ? 1 HFIP-2 0.25 ? v/v '[U-2H]' 1 HEPES-3 2 ? mM ? 1 DSS-4 0.1 ? mM ? 1 10E8p-5 0.5 ? mM ? 2 HFIP-6 0.25 ? v/v '[U-2H]' 2 HEPES-7 2 ? mM ? 2 DSS-8 0.1 ? mM ? 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2NCT _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 361 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 182 _pdbx_nmr_constraints.NOE_long_range_total_count ? _pdbx_nmr_constraints.NOE_medium_range_total_count 82 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 97 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 29 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 29 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 3 ? ? 63.04 170.32 2 1 ASP A 5 ? ? 54.57 89.45 3 1 LYS A 35 ? ? 59.20 176.09 4 2 LYS A 2 ? ? -169.87 -67.53 5 3 ASP A 5 ? ? -171.87 -178.88 6 4 LYS A 2 ? ? -171.30 125.57 7 4 LYS A 35 ? ? 57.90 85.48 8 5 LYS A 2 ? ? 55.86 91.94 9 5 LYS A 3 ? ? 61.27 99.00 10 6 LYS A 4 ? ? 59.85 177.99 11 7 LYS A 3 ? ? -159.44 -67.58 12 7 ASP A 5 ? ? 59.80 96.35 13 7 LYS A 35 ? ? -67.07 89.77 14 9 LYS A 2 ? ? 57.28 83.11 15 9 LYS A 35 ? ? -63.86 -174.70 16 10 LYS A 2 ? ? -152.69 -64.01 17 11 LYS A 3 ? ? -165.09 114.59 18 11 LYS A 35 ? ? 59.46 179.03 19 12 LYS A 3 ? ? 62.23 169.00 20 12 LYS A 35 ? ? 53.45 70.60 21 13 LYS A 35 ? ? 56.33 70.05 22 14 LYS A 2 ? ? 62.93 163.38 23 14 LYS A 3 ? ? -125.34 -72.60 24 14 LYS A 4 ? ? 58.42 -177.88 25 15 LYS A 2 ? ? 59.29 -174.81 26 16 LYS A 2 ? ? 63.13 73.69 27 17 ASP A 5 ? ? 62.93 165.58 28 19 LYS A 3 ? ? -97.79 51.58 29 20 ASP A 5 ? ? 56.49 90.57 #