data_2PYP # _entry.id 2PYP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2PYP WWPDB D_1000178525 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2PYP _pdbx_database_status.recvd_initial_deposition_date 1997-02-03 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Genick, U.K.' 1 'Borgstahl, G.E.O.' 2 'Ng, K.' 3 'Ren, Z.' 4 'Pradervand, C.' 5 'Burke, P.' 6 'Srajer, V.' 7 'Teng, T.' 8 'Schildkamp, W.' 9 'Mcree, D.E.' 10 'Moffat, K.' 11 'Getzoff, E.D.' 12 # _citation.id primary _citation.title 'Structure of a protein photocycle intermediate by millisecond time-resolved crystallography.' _citation.journal_abbrev Science _citation.journal_volume 275 _citation.page_first 1471 _citation.page_last 1475 _citation.year 1997 _citation.journal_id_ASTM SCIEAS _citation.country US _citation.journal_id_ISSN 0036-8075 _citation.journal_id_CSD 0038 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9045611 _citation.pdbx_database_id_DOI 10.1126/science.275.5305.1471 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Genick, U.K.' 1 primary 'Borgstahl, G.E.' 2 primary 'Ng, K.' 3 primary 'Ren, Z.' 4 primary 'Pradervand, C.' 5 primary 'Burke, P.M.' 6 primary 'Srajer, V.' 7 primary 'Teng, T.Y.' 8 primary 'Schildkamp, W.' 9 primary 'McRee, D.E.' 10 primary 'Moffat, K.' 11 primary 'Getzoff, E.D.' 12 # _cell.entry_id 2PYP _cell.length_a 66.900 _cell.length_b 66.900 _cell.length_c 40.800 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2PYP _symmetry.space_group_name_H-M 'P 63' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 173 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'PHOTOACTIVE YELLOW PROTEIN' 13888.575 1 ? ? ? ? 2 non-polymer syn ;4'-HYDROXYCINNAMIC ACID ; 164.158 1 ? ? ? ? 3 water nat water 18.015 56 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFK EGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV ; _entity_poly.pdbx_seq_one_letter_code_can ;MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFK EGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 HIS n 1 4 VAL n 1 5 ALA n 1 6 PHE n 1 7 GLY n 1 8 SER n 1 9 GLU n 1 10 ASP n 1 11 ILE n 1 12 GLU n 1 13 ASN n 1 14 THR n 1 15 LEU n 1 16 ALA n 1 17 LYS n 1 18 MET n 1 19 ASP n 1 20 ASP n 1 21 GLY n 1 22 GLN n 1 23 LEU n 1 24 ASP n 1 25 GLY n 1 26 LEU n 1 27 ALA n 1 28 PHE n 1 29 GLY n 1 30 ALA n 1 31 ILE n 1 32 GLN n 1 33 LEU n 1 34 ASP n 1 35 GLY n 1 36 ASP n 1 37 GLY n 1 38 ASN n 1 39 ILE n 1 40 LEU n 1 41 GLN n 1 42 TYR n 1 43 ASN n 1 44 ALA n 1 45 ALA n 1 46 GLU n 1 47 GLY n 1 48 ASP n 1 49 ILE n 1 50 THR n 1 51 GLY n 1 52 ARG n 1 53 ASP n 1 54 PRO n 1 55 LYS n 1 56 GLN n 1 57 VAL n 1 58 ILE n 1 59 GLY n 1 60 LYS n 1 61 ASN n 1 62 PHE n 1 63 PHE n 1 64 LYS n 1 65 ASP n 1 66 VAL n 1 67 ALA n 1 68 PRO n 1 69 CYS n 1 70 THR n 1 71 ASP n 1 72 SER n 1 73 PRO n 1 74 GLU n 1 75 PHE n 1 76 TYR n 1 77 GLY n 1 78 LYS n 1 79 PHE n 1 80 LYS n 1 81 GLU n 1 82 GLY n 1 83 VAL n 1 84 ALA n 1 85 SER n 1 86 GLY n 1 87 ASN n 1 88 LEU n 1 89 ASN n 1 90 THR n 1 91 MET n 1 92 PHE n 1 93 GLU n 1 94 TYR n 1 95 THR n 1 96 PHE n 1 97 ASP n 1 98 TYR n 1 99 GLN n 1 100 MET n 1 101 THR n 1 102 PRO n 1 103 THR n 1 104 LYS n 1 105 VAL n 1 106 LYS n 1 107 VAL n 1 108 HIS n 1 109 MET n 1 110 LYS n 1 111 LYS n 1 112 ALA n 1 113 LEU n 1 114 SER n 1 115 GLY n 1 116 ASP n 1 117 SER n 1 118 TYR n 1 119 TRP n 1 120 VAL n 1 121 PHE n 1 122 VAL n 1 123 LYS n 1 124 ARG n 1 125 VAL n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Halorhodospira halophila' _entity_src_nat.pdbx_ncbi_taxonomy_id 1053 _entity_src_nat.genus Halorhodospira _entity_src_nat.species ? _entity_src_nat.strain BN9626 _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PYP_ECTHA _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P16113 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFK EGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2PYP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 125 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P16113 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 125 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 125 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HC4 non-polymer . ;4'-HYDROXYCINNAMIC ACID ; 'PARA-COUMARIC ACID' 'C9 H8 O3' 164.158 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2PYP _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.88 _exptl_crystal.density_percent_sol 35. _exptl_crystal.description 'THE MODEL OF THE GROUND STATE STRUCTURE WAS USED' # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.8 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 4.8' # _diffrn.id 1 _diffrn.ambient_temp 261 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type FUJI _diffrn_detector.pdbx_collection_date 1993-06 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l L _diffrn_radiation.monochromator 'ALUMINUM FOIL 150 MICRON' _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.7 1.0 2 2.0 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X26C' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X26C _diffrn_source.pdbx_wavelength 0.7 _diffrn_source.pdbx_wavelength_list '0.7, 2.0' # _reflns.entry_id 2PYP _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 10.0 _reflns.d_resolution_high 1.9 _reflns.number_obs 10354 _reflns.number_all ? _reflns.percent_possible_obs 92.3 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 5.5 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.9 _reflns_shell.d_res_low 2.1 _reflns_shell.percent_possible_all 86.0 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 2PYP _refine.ls_number_reflns_obs 7392 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 3.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 10.0 _refine.ls_d_res_high 1.9 _refine.ls_percent_reflns_obs 89.3 _refine.ls_R_factor_obs 0.2040000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2040000 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1072 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 11 _refine_hist.number_atoms_solvent 56 _refine_hist.number_atoms_total 1139 _refine_hist.d_res_high 1.9 _refine_hist.d_res_low 10.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.013 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.605 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 8 _refine_ls_shell.d_res_high 1.9 _refine_ls_shell.d_res_low 1.99 _refine_ls_shell.number_reflns_R_work 765 _refine_ls_shell.R_factor_R_work 0.2800000 _refine_ls_shell.percent_reflns_obs 74.34 _refine_ls_shell.R_factor_R_free ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PARHCSDX.PRO TOPH19.PEP 'X-RAY DIFFRACTION' 2 ? ? 'X-RAY DIFFRACTION' # _struct.entry_id 2PYP _struct.title 'PHOTOACTIVE YELLOW PROTEIN, PHOTOSTATIONARY STATE, 50% GROUND STATE, 50% BLEACHED' _struct.pdbx_descriptor ;PHOTOACTIVE YELLOW PROTEIN, 4'-HYDROXYCINNAMIC ACID ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2PYP _struct_keywords.pdbx_keywords PHOTORECEPTOR _struct_keywords.text 'PHOTORECEPTOR, CHROMOPHORE, LIGHT SENSOR FOR PHOTOTAXIS' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 A-1 ILE A 11 ? LEU A 15 ? ILE A 11 LEU A 15 1 ? 5 HELX_P HELX_P2 A-2 ASP A 19 ? LEU A 23 ? ASP A 19 LEU A 23 1 ? 5 HELX_P HELX_P3 A-3 ASN A 43 ? THR A 50 ? ASN A 43 THR A 50 1 ? 8 HELX_P HELX_P4 A-4 ASP A 53 ? VAL A 57 ? ASP A 53 VAL A 57 1 ? 5 HELX_P HELX_P5 PI ASN A 61 ? ALA A 67 ? ASN A 61 ALA A 67 3 ? 7 HELX_P HELX_P6 A-5 PHE A 75 ? GLY A 86 ? PHE A 75 GLY A 86 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? B HC4 . C1 A ? ? 1_555 A CYS 69 SG A ? A HC4 126 A CYS 69 1_555 ? ? ? ? ? ? ? 1.750 ? covale2 covale ? ? B HC4 . C1 A ? ? 1_555 A CYS 69 SG B ? A HC4 126 A CYS 69 1_555 ? ? ? ? ? ? ? 2.017 ? covale3 covale ? ? B HC4 . C1 B ? ? 1_555 A CYS 69 SG A ? A HC4 126 A CYS 69 1_555 ? ? ? ? ? ? ? 1.476 ? covale4 covale ? ? B HC4 . C1 B ? ? 1_555 A CYS 69 SG B ? A HC4 126 A CYS 69 1_555 ? ? ? ? ? ? ? 1.744 ? covale5 covale ? ? B HC4 . "C3'" B ? ? 1_555 A ARG 52 NH2 A ? A HC4 126 A ARG 52 1_555 ? ? ? ? ? ? ? 1.669 ? covale6 covale ? ? B HC4 . "C4'" B ? ? 1_555 A ARG 52 NE A ? A HC4 126 A ARG 52 1_555 ? ? ? ? ? ? ? 2.025 ? covale7 covale ? ? B HC4 . "C4'" B ? ? 1_555 A ARG 52 CZ A ? A HC4 126 A ARG 52 1_555 ? ? ? ? ? ? ? 1.459 ? covale8 covale ? ? B HC4 . "C4'" B ? ? 1_555 A ARG 52 NH2 A ? A HC4 126 A ARG 52 1_555 ? ? ? ? ? ? ? 1.571 ? covale9 covale ? ? B HC4 . "O4'" B ? ? 1_555 A ARG 52 NE A ? A HC4 126 A ARG 52 1_555 ? ? ? ? ? ? ? 1.026 ? covale10 covale ? ? B HC4 . "O4'" B ? ? 1_555 A ARG 52 CZ A ? A HC4 126 A ARG 52 1_555 ? ? ? ? ? ? ? 0.778 ? covale11 covale ? ? B HC4 . "O4'" B ? ? 1_555 A ARG 52 NH1 A ? A HC4 126 A ARG 52 1_555 ? ? ? ? ? ? ? 2.063 ? covale12 covale ? ? B HC4 . "O4'" B ? ? 1_555 A ARG 52 NH2 A ? A HC4 126 A ARG 52 1_555 ? ? ? ? ? ? ? 1.332 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details B-1 ? 6 ? B-2 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense B-1 1 2 ? anti-parallel B-1 2 3 ? anti-parallel B-1 3 4 ? anti-parallel B-1 4 5 ? anti-parallel B-1 5 6 ? anti-parallel B-2 1 2 ? anti-parallel B-2 2 3 ? anti-parallel B-2 3 4 ? anti-parallel B-2 4 5 ? anti-parallel B-2 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id B-1 1 LYS A 60 ? PHE A 62 ? LYS A 60 PHE A 62 B-1 2 GLY A 37 ? GLN A 41 ? GLY A 37 GLN A 41 B-1 3 GLY A 29 ? ASP A 34 ? GLY A 29 ASP A 34 B-1 4 SER A 117 ? VAL A 125 ? SER A 117 VAL A 125 B-1 5 THR A 103 ? ALA A 112 ? THR A 103 ALA A 112 B-1 6 LEU A 88 ? PHE A 96 ? LEU A 88 PHE A 96 B-2 1 LYS A 60 ? PHE A 62 ? LYS A 60 PHE A 62 B-2 2 GLY A 37 ? GLN A 41 ? GLY A 37 GLN A 41 B-2 3 GLY A 29 ? ASP A 34 ? GLY A 29 ASP A 34 B-2 4 SER A 117 ? VAL A 125 ? SER A 117 VAL A 125 B-2 5 THR A 103 ? ALA A 112 ? THR A 103 ALA A 112 B-2 6 LEU A 88 ? PHE A 96 ? LEU A 88 PHE A 96 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id B-1 1 2 N PHE A 62 ? N PHE A 62 O GLY A 37 ? O GLY A 37 B-1 2 3 N LEU A 40 ? N LEU A 40 O GLN A 32 ? O GLN A 32 B-1 3 4 N ILE A 31 ? N ILE A 31 O VAL A 120 ? O VAL A 120 B-1 4 5 N PHE A 121 ? N PHE A 121 O HIS A 108 ? O HIS A 108 B-1 5 6 N MET A 109 ? N MET A 109 O THR A 90 ? O THR A 90 B-2 1 2 N PHE A 62 ? N PHE A 62 O GLY A 37 ? O GLY A 37 B-2 2 3 N LEU A 40 ? N LEU A 40 O GLN A 32 ? O GLN A 32 B-2 3 4 N ILE A 31 ? N ILE A 31 O VAL A 120 ? O VAL A 120 B-2 4 5 N PHE A 121 ? N PHE A 121 O HIS A 108 ? O HIS A 108 B-2 5 6 N MET A 109 ? N MET A 109 O THR A 90 ? O THR A 90 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 12 _struct_site.details 'BINDING SITE FOR RESIDUE HC4 A 126' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 12 TYR A 42 ? TYR A 42 . ? 1_555 ? 2 AC1 12 GLU A 46 ? GLU A 46 . ? 1_555 ? 3 AC1 12 THR A 50 ? THR A 50 . ? 1_555 ? 4 AC1 12 ARG A 52 ? ARG A 52 . ? 1_555 ? 5 AC1 12 VAL A 66 ? VAL A 66 . ? 1_555 ? 6 AC1 12 ALA A 67 ? ALA A 67 . ? 1_555 ? 7 AC1 12 PRO A 68 ? PRO A 68 . ? 1_555 ? 8 AC1 12 CYS A 69 ? CYS A 69 . ? 1_555 ? 9 AC1 12 THR A 70 ? THR A 70 . ? 1_555 ? 10 AC1 12 PHE A 96 ? PHE A 96 . ? 1_555 ? 11 AC1 12 TYR A 98 ? TYR A 98 . ? 1_555 ? 12 AC1 12 MET A 100 ? MET A 100 . ? 1_555 ? # _database_PDB_matrix.entry_id 2PYP _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2PYP _atom_sites.fract_transf_matrix[1][1] 0.014948 _atom_sites.fract_transf_matrix[1][2] 0.008630 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017260 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.024510 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 CYS 69 69 69 CYS CYS A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 MET 91 91 91 MET MET A . n A 1 92 PHE 92 92 92 PHE PHE A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 TYR 94 94 94 TYR TYR A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 TYR 98 98 98 TYR TYR A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 MET 100 100 100 MET MET A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 HIS 108 108 108 HIS HIS A . n A 1 109 MET 109 109 109 MET MET A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 TRP 119 119 119 TRP TRP A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 PHE 121 121 121 PHE PHE A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 VAL 125 125 125 VAL VAL A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HC4 1 126 69 HC4 HC4 A . C 3 HOH 1 200 200 HOH HOH A . C 3 HOH 2 201 201 HOH HOH A . C 3 HOH 3 202 202 HOH HOH A . C 3 HOH 4 203 203 HOH HOH A . C 3 HOH 5 204 204 HOH HOH A . C 3 HOH 6 206 206 HOH HOH A . C 3 HOH 7 207 207 HOH HOH A . C 3 HOH 8 208 208 HOH HOH A . C 3 HOH 9 209 209 HOH HOH A . C 3 HOH 10 210 210 HOH HOH A . C 3 HOH 11 211 211 HOH HOH A . C 3 HOH 12 212 212 HOH HOH A . C 3 HOH 13 213 213 HOH HOH A . C 3 HOH 14 214 214 HOH HOH A . C 3 HOH 15 217 217 HOH HOH A . C 3 HOH 16 218 218 HOH HOH A . C 3 HOH 17 220 220 HOH HOH A . C 3 HOH 18 221 221 HOH HOH A . C 3 HOH 19 222 222 HOH HOH A . C 3 HOH 20 223 223 HOH HOH A . C 3 HOH 21 224 224 HOH HOH A . C 3 HOH 22 225 225 HOH HOH A . C 3 HOH 23 226 226 HOH HOH A . C 3 HOH 24 227 227 HOH HOH A . C 3 HOH 25 229 229 HOH HOH A . C 3 HOH 26 231 231 HOH HOH A . C 3 HOH 27 232 232 HOH HOH A . C 3 HOH 28 233 233 HOH HOH A . C 3 HOH 29 234 234 HOH HOH A . C 3 HOH 30 235 235 HOH HOH A . C 3 HOH 31 236 236 HOH HOH A . C 3 HOH 32 237 237 HOH HOH A . C 3 HOH 33 240 240 HOH HOH A . C 3 HOH 34 241 241 HOH HOH A . C 3 HOH 35 244 244 HOH HOH A . C 3 HOH 36 245 245 HOH HOH A . C 3 HOH 37 248 248 HOH HOH A . C 3 HOH 38 249 249 HOH HOH A . C 3 HOH 39 250 250 HOH HOH A . C 3 HOH 40 251 251 HOH HOH A . C 3 HOH 41 253 253 HOH HOH A . C 3 HOH 42 254 254 HOH HOH A . C 3 HOH 43 257 257 HOH HOH A . C 3 HOH 44 258 258 HOH HOH A . C 3 HOH 45 260 260 HOH HOH A . C 3 HOH 46 261 261 HOH HOH A . C 3 HOH 47 262 262 HOH HOH A . C 3 HOH 48 264 264 HOH HOH A . C 3 HOH 49 274 274 HOH HOH A . C 3 HOH 50 277 277 HOH HOH A . C 3 HOH 51 278 278 HOH HOH A . C 3 HOH 52 279 279 HOH HOH A . C 3 HOH 53 282 282 HOH HOH A . C 3 HOH 54 284 284 HOH HOH A . C 3 HOH 55 286 286 HOH HOH A . C 3 HOH 56 290 290 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-04-29 2 'Structure model' 1 1 2008-03-25 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other 5 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' software 3 4 'Structure model' struct_conf 4 4 'Structure model' struct_conf_type # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.process_site' 2 4 'Structure model' '_software.name' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 LaueView 'data reduction' . ? 3 LaueView 'data scaling' . ? 4 X-PLOR phasing 3.1 ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 75 ? ? -130.59 -74.27 2 1 ASN A 89 ? ? -163.00 94.56 3 1 ASP A 97 ? ? -141.79 18.54 4 1 ASP A 116 ? ? -107.86 58.81 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;4'-HYDROXYCINNAMIC ACID ; HC4 3 water HOH #