data_2QZD # _entry.id 2QZD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.296 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2QZD RCSB RCSB044235 WWPDB D_1000044235 # _pdbx_database_related.db_name EMDB _pdbx_database_related.db_id EMD-1412 _pdbx_database_related.details . _pdbx_database_related.content_type 'associated EM volume' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2QZD _pdbx_database_status.recvd_initial_deposition_date 2007-08-16 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hafenstein, S.' 1 'Bowman, V.D.' 2 'Chipman, P.R.' 3 'Bator Kelly, C.M.' 4 'Lin, F.' 5 'Medof, M.E.' 6 'Rossmann, M.G.' 7 # _citation.id primary _citation.title 'Interaction of decay-accelerating factor with coxsackievirus b3.' _citation.journal_abbrev J.Virol. _citation.journal_volume 81 _citation.page_first 12927 _citation.page_last 12935 _citation.year 2007 _citation.journal_id_ASTM JOVIAM _citation.country US _citation.journal_id_ISSN 0022-538X _citation.journal_id_CSD 0825 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17804498 _citation.pdbx_database_id_DOI 10.1128/JVI.00931-07 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Hafenstein, S.' 1 primary 'Bowman, V.D.' 2 primary 'Chipman, P.R.' 3 primary 'Bator Kelly, C.M.' 4 primary 'Lin, F.' 5 primary 'Medof, M.E.' 6 primary 'Rossmann, M.G.' 7 # _cell.entry_id 2QZD _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.pdbx_unique_axis ? _cell.Z_PDB 1 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2QZD _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.Int_Tables_number 1 _symmetry.cell_setting ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Complement decay-accelerating factor' _entity.formula_weight 7274.988 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SCR4 domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CD55 antigen' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code EIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGC _entity_poly.pdbx_seq_one_letter_code_can EIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGC _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 ILE n 1 3 TYR n 1 4 CYS n 1 5 PRO n 1 6 ALA n 1 7 PRO n 1 8 PRO n 1 9 GLN n 1 10 ILE n 1 11 ASP n 1 12 ASN n 1 13 GLY n 1 14 ILE n 1 15 ILE n 1 16 GLN n 1 17 GLY n 1 18 GLU n 1 19 ARG n 1 20 ASP n 1 21 HIS n 1 22 TYR n 1 23 GLY n 1 24 TYR n 1 25 ARG n 1 26 GLN n 1 27 SER n 1 28 VAL n 1 29 THR n 1 30 TYR n 1 31 ALA n 1 32 CYS n 1 33 ASN n 1 34 LYS n 1 35 GLY n 1 36 PHE n 1 37 THR n 1 38 MET n 1 39 ILE n 1 40 GLY n 1 41 GLU n 1 42 HIS n 1 43 SER n 1 44 ILE n 1 45 TYR n 1 46 CYS n 1 47 THR n 1 48 VAL n 1 49 ASN n 1 50 ASN n 1 51 ASP n 1 52 GLU n 1 53 GLY n 1 54 GLU n 1 55 TRP n 1 56 SER n 1 57 GLY n 1 58 PRO n 1 59 PRO n 1 60 PRO n 1 61 GLU n 1 62 CYS n 1 63 ARG n 1 64 GLY n 1 65 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'CD55, CR, DAF' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DAF_HUMAN _struct_ref.pdbx_db_accession P08174 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code EIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRG _struct_ref.pdbx_align_begin 222 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2QZD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 64 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P08174 _struct_ref_seq.db_align_beg 222 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 285 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1190 _struct_ref_seq.pdbx_auth_seq_align_end 1253 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2QZD _struct_ref_seq_dif.mon_id CYS _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 65 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P08174 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details INSERTION _struct_ref_seq_dif.pdbx_auth_seq_num 1254 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2QZD _exptl.method 'ELECTRON MICROSCOPY' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.density_Matthews ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _refine_hist.pdbx_refine_id 'ELECTRON MICROSCOPY' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 507 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 507 _refine_hist.d_res_high . _refine_hist.d_res_low . # _struct.entry_id 2QZD _struct.title 'Fitted structure of SCR4 of DAF into cryoEM density' _struct.pdbx_descriptor 'Complement decay-accelerating factor' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2QZD _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' _struct_keywords.text ;SCR4 of DAF from 1ojv fitted into cryoEM density, Blood group antigen, Complement pathway, Glycoprotein, GPI-anchor, Immune response, Innate immunity, Lipoprotein, Membrane, Sushi, IMMUNE SYSTEM ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 46 SG ? ? A CYS 1193 A CYS 1235 1_555 ? ? ? ? ? ? ? 2.029 ? disulf2 disulf ? ? A CYS 32 SG ? ? ? 1_555 A CYS 62 SG ? ? A CYS 1221 A CYS 1251 1_555 ? ? ? ? ? ? ? 2.031 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 64 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 1253 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 CYS _struct_mon_prot_cis.pdbx_label_seq_id_2 65 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 CYS _struct_mon_prot_cis.pdbx_auth_seq_id_2 1254 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 29.05 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 13 ? ILE A 15 ? GLY A 1202 ILE A 1204 A 2 SER A 27 ? CYS A 32 ? SER A 1216 CYS A 1221 A 3 SER A 43 ? ASN A 49 ? SER A 1232 ASN A 1238 A 4 GLU A 52 ? TRP A 55 ? GLU A 1241 TRP A 1244 B 1 THR A 37 ? ILE A 39 ? THR A 1226 ILE A 1228 B 2 GLU A 61 ? ARG A 63 ? GLU A 1250 ARG A 1252 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 14 ? N ILE A 1203 O ALA A 31 ? O ALA A 1220 A 2 3 N VAL A 28 ? N VAL A 1217 O ILE A 44 ? O ILE A 1233 A 3 4 N THR A 47 ? N THR A 1236 O GLU A 54 ? O GLU A 1243 B 1 2 N THR A 37 ? N THR A 1226 O ARG A 63 ? O ARG A 1252 # _database_PDB_matrix.entry_id 2QZD _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2QZD _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1190 1190 GLU GLU A . n A 1 2 ILE 2 1191 1191 ILE ILE A . n A 1 3 TYR 3 1192 1192 TYR TYR A . n A 1 4 CYS 4 1193 1193 CYS CYS A . n A 1 5 PRO 5 1194 1194 PRO PRO A . n A 1 6 ALA 6 1195 1195 ALA ALA A . n A 1 7 PRO 7 1196 1196 PRO PRO A . n A 1 8 PRO 8 1197 1197 PRO PRO A . n A 1 9 GLN 9 1198 1198 GLN GLN A . n A 1 10 ILE 10 1199 1199 ILE ILE A . n A 1 11 ASP 11 1200 1200 ASP ASP A . n A 1 12 ASN 12 1201 1201 ASN ASN A . n A 1 13 GLY 13 1202 1202 GLY GLY A . n A 1 14 ILE 14 1203 1203 ILE ILE A . n A 1 15 ILE 15 1204 1204 ILE ILE A . n A 1 16 GLN 16 1205 1205 GLN GLN A . n A 1 17 GLY 17 1206 1206 GLY GLY A . n A 1 18 GLU 18 1207 1207 GLU GLU A . n A 1 19 ARG 19 1208 1208 ARG ARG A . n A 1 20 ASP 20 1209 1209 ASP ASP A . n A 1 21 HIS 21 1210 1210 HIS HIS A . n A 1 22 TYR 22 1211 1211 TYR TYR A . n A 1 23 GLY 23 1212 1212 GLY GLY A . n A 1 24 TYR 24 1213 1213 TYR TYR A . n A 1 25 ARG 25 1214 1214 ARG ARG A . n A 1 26 GLN 26 1215 1215 GLN GLN A . n A 1 27 SER 27 1216 1216 SER SER A . n A 1 28 VAL 28 1217 1217 VAL VAL A . n A 1 29 THR 29 1218 1218 THR THR A . n A 1 30 TYR 30 1219 1219 TYR TYR A . n A 1 31 ALA 31 1220 1220 ALA ALA A . n A 1 32 CYS 32 1221 1221 CYS CYS A . n A 1 33 ASN 33 1222 1222 ASN ASN A . n A 1 34 LYS 34 1223 1223 LYS LYS A . n A 1 35 GLY 35 1224 1224 GLY GLY A . n A 1 36 PHE 36 1225 1225 PHE PHE A . n A 1 37 THR 37 1226 1226 THR THR A . n A 1 38 MET 38 1227 1227 MET MET A . n A 1 39 ILE 39 1228 1228 ILE ILE A . n A 1 40 GLY 40 1229 1229 GLY GLY A . n A 1 41 GLU 41 1230 1230 GLU GLU A . n A 1 42 HIS 42 1231 1231 HIS HIS A . n A 1 43 SER 43 1232 1232 SER SER A . n A 1 44 ILE 44 1233 1233 ILE ILE A . n A 1 45 TYR 45 1234 1234 TYR TYR A . n A 1 46 CYS 46 1235 1235 CYS CYS A . n A 1 47 THR 47 1236 1236 THR THR A . n A 1 48 VAL 48 1237 1237 VAL VAL A . n A 1 49 ASN 49 1238 1238 ASN ASN A . n A 1 50 ASN 50 1239 1239 ASN ASN A . n A 1 51 ASP 51 1240 1240 ASP ASP A . n A 1 52 GLU 52 1241 1241 GLU GLU A . n A 1 53 GLY 53 1242 1242 GLY GLY A . n A 1 54 GLU 54 1243 1243 GLU GLU A . n A 1 55 TRP 55 1244 1244 TRP TRP A . n A 1 56 SER 56 1245 1245 SER SER A . n A 1 57 GLY 57 1246 1246 GLY GLY A . n A 1 58 PRO 58 1247 1247 PRO PRO A . n A 1 59 PRO 59 1248 1248 PRO PRO A . n A 1 60 PRO 60 1249 1249 PRO PRO A . n A 1 61 GLU 61 1250 1250 GLU GLU A . n A 1 62 CYS 62 1251 1251 CYS CYS A . n A 1 63 ARG 63 1252 1252 ARG ARG A . n A 1 64 GLY 64 1253 1253 GLY GLY A . n A 1 65 CYS 65 1254 1254 CYS CYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-30 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2012-05-30 4 'Structure model' 1 3 2018-07-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Refinement description' 3 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' em_image_scans 2 4 'Structure model' em_software # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_em_software.image_processing_id' # _em_3d_fitting.id 1 _em_3d_fitting.entry_id 2QZD _em_3d_fitting.ref_protocol ? _em_3d_fitting.ref_space ? _em_3d_fitting.overall_b_value ? _em_3d_fitting.target_criteria ? _em_3d_fitting.details ? _em_3d_fitting.method ? # _em_3d_fitting_list.3d_fitting_id 1 _em_3d_fitting_list.id 1 _em_3d_fitting_list.pdb_entry_id 1OJV _em_3d_fitting_list.pdb_chain_id ? _em_3d_fitting_list.details ? # _em_3d_reconstruction.entry_id 2QZD _em_3d_reconstruction.id 1 _em_3d_reconstruction.symmetry_type POINT _em_3d_reconstruction.num_particles 2269 _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.method ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.resolution 14 _em_3d_reconstruction.resolution_method ? _em_3d_reconstruction.magnification_calibration ? _em_3d_reconstruction.details ? _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.algorithm ? # _em_buffer.id 1 _em_buffer.specimen_id 1 _em_buffer.name '50mM MES' _em_buffer.pH 6 _em_buffer.details '50mM MES' # loop_ _em_entity_assembly.id _em_entity_assembly.name _em_entity_assembly.type _em_entity_assembly.parent_id _em_entity_assembly.synonym _em_entity_assembly.details _em_entity_assembly.oligomeric_details 1 'coxsackievirus B3, RD strain, complexed with decay-accelerating factor' VIRUS 0 ? 'one DAF binds each binding site, one per each protomer' ? 2 'Complement decay-accelerating factor' ? 1 ? ? ? # _em_imaging.entry_id 2QZD _em_imaging.id 1 _em_imaging.nominal_magnification 45000 _em_imaging.specimen_id 1 _em_imaging.date 2004-08-06 _em_imaging.temperature 93 _em_imaging.microscope_model 'FEI/PHILIPS CM300FEG/T' _em_imaging.nominal_defocus_min 1.0 _em_imaging.nominal_defocus_max 4.6 _em_imaging.tilt_angle_min 0 _em_imaging.tilt_angle_max ? _em_imaging.nominal_cs 2.0 _em_imaging.mode 'BRIGHT FIELD' _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.calibrated_magnification ? _em_imaging.electron_source 'TUNGSTEN HAIRPIN' _em_imaging.accelerating_voltage 300 _em_imaging.details ? _em_imaging.specimen_holder_type ? _em_imaging.specimen_holder_model ? _em_imaging.citation_id ? _em_imaging.detector_distance ? _em_imaging.recording_temperature_maximum ? _em_imaging.recording_temperature_minimum ? _em_imaging.astigmatism ? _em_imaging.electron_beam_tilt_params ? # _em_sample_support.id 1 _em_sample_support.specimen_id 1 _em_sample_support.details quantifoils _em_sample_support.film_material ? _em_sample_support.grid_material ? _em_sample_support.grid_mesh_size ? _em_sample_support.grid_type ? _em_sample_support.method ? # _em_vitrification.entry_id 2QZD _em_vitrification.id 1 _em_vitrification.instrument 'HOMEMADE PLUNGER' _em_vitrification.cryogen_name ETHANE _em_vitrification.details 'blot before plunging' _em_vitrification.citation_id ? _em_vitrification.humidity ? _em_vitrification.method ? _em_vitrification.specimen_id 1 _em_vitrification.temp ? _em_vitrification.time_resolved_state ? # _em_experiment.entry_id 2QZD _em_experiment.id 1 _em_experiment.aggregation_state PARTICLE _em_experiment.entity_assembly_id 1 _em_experiment.reconstruction_method 'SINGLE PARTICLE' # _em_single_particle_entity.entry_id 2QZD _em_single_particle_entity.id 1 _em_single_particle_entity.point_symmetry I _em_single_particle_entity.image_processing_id 1 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ARG _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 1214 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 73.17 _pdbx_validate_torsion.psi -5.08 # _em_image_processing.id 1 _em_image_processing.image_recording_id 1 _em_image_processing.details ? # _em_image_recording.avg_electron_dose_per_image 24 _em_image_recording.details ? _em_image_recording.id 1 _em_image_recording.film_or_detector_model 'KODAK SO-163 FILM' _em_image_recording.imaging_id 1 _em_image_recording.detector_mode ? _em_image_recording.average_exposure_time ? _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images ? # loop_ _em_software.id _em_software.name _em_software.version _em_software.category _em_software.details _em_software.image_processing_id 1 EM3DR ? RECONSTRUCTION ? 1 2 EMPFT ? RECONSTRUCTION ? 1 # _em_specimen.experiment_id 1 _em_specimen.id 1 _em_specimen.concentration 2 _em_specimen.vitrification_applied YES _em_specimen.staining_applied NO _em_specimen.embedding_applied NO _em_specimen.shadowing_applied NO _em_specimen.details ? #