data_2RE7 # _entry.id 2RE7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.365 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2RE7 pdb_00002re7 10.2210/pdb2re7/pdb RCSB RCSB044753 ? ? WWPDB D_1000044753 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id 380202 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.SG_entry Y _pdbx_database_status.entry_id 2RE7 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-09-25 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Joint Center for Structural Genomics (JCSG)' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'Crystal structure of General Stress Protein COG3871 (YP_263493.1) from Psychrobacter arcticus 273-4 at 2.50 A resolution' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # _citation_author.citation_id primary _citation_author.name 'Joint Center for Structural Genomics (JCSG)' _citation_author.ordinal 1 _citation_author.identifier_ORCID ? # _cell.entry_id 2RE7 _cell.length_a 106.063 _cell.length_b 106.063 _cell.length_c 87.218 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.pdbx_unique_axis ? _cell.Z_PDB 16 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2RE7 _symmetry.Int_Tables_number 98 _symmetry.space_group_name_H-M 'I 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Uncharacterized protein' 15088.486 1 ? ? 'Residues 1-133' ? 2 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 3 water nat water 18.015 24 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;G(MSE)SNQKHIDKIQAVIKDVKFA(MSE)ISTSNKKGDIHAWP(MSE)TTSEVNLDNKEIWFIGDKTSDVVKDIQDDAR IGLTYATQDEKNYVSISGDAELPTDKAKLDELWSPVYSAFFANGKEDANIQLIKVVPHGVECWLSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GMSNQKHIDKIQAVIKDVKFAMISTSNKKGDIHAWPMTTSEVNLDNKEIWFIGDKTSDVVKDIQDDARIGLTYATQDEKN YVSISGDAELPTDKAKLDELWSPVYSAFFANGKEDANIQLIKVVPHGVECWLSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier 380202 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 MSE n 1 3 SER n 1 4 ASN n 1 5 GLN n 1 6 LYS n 1 7 HIS n 1 8 ILE n 1 9 ASP n 1 10 LYS n 1 11 ILE n 1 12 GLN n 1 13 ALA n 1 14 VAL n 1 15 ILE n 1 16 LYS n 1 17 ASP n 1 18 VAL n 1 19 LYS n 1 20 PHE n 1 21 ALA n 1 22 MSE n 1 23 ILE n 1 24 SER n 1 25 THR n 1 26 SER n 1 27 ASN n 1 28 LYS n 1 29 LYS n 1 30 GLY n 1 31 ASP n 1 32 ILE n 1 33 HIS n 1 34 ALA n 1 35 TRP n 1 36 PRO n 1 37 MSE n 1 38 THR n 1 39 THR n 1 40 SER n 1 41 GLU n 1 42 VAL n 1 43 ASN n 1 44 LEU n 1 45 ASP n 1 46 ASN n 1 47 LYS n 1 48 GLU n 1 49 ILE n 1 50 TRP n 1 51 PHE n 1 52 ILE n 1 53 GLY n 1 54 ASP n 1 55 LYS n 1 56 THR n 1 57 SER n 1 58 ASP n 1 59 VAL n 1 60 VAL n 1 61 LYS n 1 62 ASP n 1 63 ILE n 1 64 GLN n 1 65 ASP n 1 66 ASP n 1 67 ALA n 1 68 ARG n 1 69 ILE n 1 70 GLY n 1 71 LEU n 1 72 THR n 1 73 TYR n 1 74 ALA n 1 75 THR n 1 76 GLN n 1 77 ASP n 1 78 GLU n 1 79 LYS n 1 80 ASN n 1 81 TYR n 1 82 VAL n 1 83 SER n 1 84 ILE n 1 85 SER n 1 86 GLY n 1 87 ASP n 1 88 ALA n 1 89 GLU n 1 90 LEU n 1 91 PRO n 1 92 THR n 1 93 ASP n 1 94 LYS n 1 95 ALA n 1 96 LYS n 1 97 LEU n 1 98 ASP n 1 99 GLU n 1 100 LEU n 1 101 TRP n 1 102 SER n 1 103 PRO n 1 104 VAL n 1 105 TYR n 1 106 SER n 1 107 ALA n 1 108 PHE n 1 109 PHE n 1 110 ALA n 1 111 ASN n 1 112 GLY n 1 113 LYS n 1 114 GLU n 1 115 ASP n 1 116 ALA n 1 117 ASN n 1 118 ILE n 1 119 GLN n 1 120 LEU n 1 121 ILE n 1 122 LYS n 1 123 VAL n 1 124 VAL n 1 125 PRO n 1 126 HIS n 1 127 GLY n 1 128 VAL n 1 129 GLU n 1 130 CYS n 1 131 TRP n 1 132 LEU n 1 133 SER n 1 134 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Psychrobacter _entity_src_gen.pdbx_gene_src_gene 'YP_263493.1, Psyc_0186' _entity_src_gen.gene_src_species 'Psychrobacter arcticus' _entity_src_gen.gene_src_strain 273-4 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Psychrobacter arcticus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 259536 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain HK100 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name speedET _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q4FV99_PSYAR _struct_ref.pdbx_db_accession Q4FV99 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSNQKHIDKIQAVIKDVKFAMISTSNKKGDIHAWPMTTSEVNLDNKEIWFIGDKTSDVVKDIQDDARIGLTYATQDEKNY VSISGDAELPTDKAKLDELWSPVYSAFFANGKEDANIQLIKVVPHGVECWLSG ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2RE7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 134 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q4FV99 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 133 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 133 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2RE7 _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q4FV99 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.method 'X-RAY DIFFRACTION' _exptl.entry_id 2RE7 # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 3.39 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 63.71 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.temp 277 _exptl_crystal_grow.pdbx_details 'NANODROP, 3.2M (NH4)2SO4, 0.1M MES pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.details 'Adjustable focusing mirrors in K-B geometry' _diffrn_detector.pdbx_collection_date 2007-08-20 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si(111) Double crystal' _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.95372 1.0 2 0.97942 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.pdbx_synchrotron_beamline 23-ID-D _diffrn_source.type 'APS BEAMLINE 23-ID-D' _diffrn_source.pdbx_wavelength_list '0.95372, 0.97942' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site APS # _reflns.entry_id 2RE7 _reflns.d_resolution_high 2.50 _reflns.d_resolution_low 28.433 _reflns.number_obs 8894 _reflns.pdbx_Rmerge_I_obs 0.090 _reflns.pdbx_netI_over_sigmaI 4.200 _reflns.pdbx_Rsym_value 0.090 _reflns.pdbx_redundancy 7.200 _reflns.percent_possible_obs 99.900 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.number_all ? _reflns.B_iso_Wilson_estimate 75.19 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 2.50 2.56 ? 4683 ? 0.010 0.7 1.046 ? 7.40 ? 636 100.00 1 1 2.56 2.64 ? 4725 ? 0.010 0.9 0.795 ? 7.40 ? 637 100.00 2 1 2.64 2.71 ? 4449 ? 0.010 1.3 0.574 ? 7.30 ? 607 100.00 3 1 2.71 2.80 ? 4441 ? 0.010 1.6 0.449 ? 7.40 ? 603 100.00 4 1 2.80 2.89 ? 4159 ? 0.010 2.3 0.317 ? 7.40 ? 565 100.00 5 1 2.89 2.99 ? 4117 ? 0.010 2.6 0.258 ? 7.40 ? 557 100.00 6 1 2.99 3.10 ? 4000 ? 0.010 3.9 0.182 ? 7.40 ? 544 100.00 7 1 3.10 3.23 ? 3774 ? 0.010 5.0 0.139 ? 7.30 ? 518 100.00 8 1 3.23 3.37 ? 3615 ? 0.010 5.6 0.112 ? 7.30 ? 497 100.00 9 1 3.37 3.54 ? 3538 ? 0.010 6.4 0.101 ? 7.30 ? 487 100.00 10 1 3.54 3.73 ? 3250 ? 0.010 7.3 0.084 ? 7.20 ? 449 100.00 11 1 3.73 3.95 ? 3255 ? 0.010 7.6 0.074 ? 7.20 ? 452 100.00 12 1 3.95 4.23 ? 2809 ? 0.010 7.8 0.071 ? 7.00 ? 399 100.00 13 1 4.23 4.56 ? 2753 ? 0.010 8.1 0.073 ? 7.00 ? 395 100.00 14 1 4.56 5.00 ? 2392 ? 0.010 6.8 0.078 ? 6.80 ? 352 100.00 15 1 5.00 5.59 ? 2311 ? 0.010 9.0 0.069 ? 7.00 ? 331 100.00 16 1 5.59 6.45 ? 1964 ? 0.010 9.3 0.065 ? 6.80 ? 287 100.00 17 1 6.45 7.91 ? 1772 ? 0.010 9.4 0.063 ? 6.80 ? 260 100.00 18 1 7.91 11.18 ? 1248 ? 0.010 6.0 0.059 ? 6.30 ? 198 100.00 19 1 11.18 28.433 ? 678 ? 0.010 7.5 0.066 ? 5.70 ? 120 95.30 20 1 # _refine.entry_id 2RE7 _refine.ls_d_res_high 2.500 _refine.ls_d_res_low 28.433 _refine.pdbx_ls_sigma_F 0.00 _refine.ls_percent_reflns_obs 99.900 _refine.ls_number_reflns_obs 8885 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details ;1. HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. 2. ATOM RECORD CONTAINS RESIDUAL B FACTORS ONLY. 3. A MET-INHIBITION PROTOCOL WAS USED FOR SELENOMETHIONINE INCORPORATION DURING PROTEIN EXPRESSION. THE OCCUPANCY OF THE SE ATOMS IN THE MSE RESIDUES WAS REDUCED TO 0.75 TO ACCOUNT FOR THE REDUCED SCATTERING POWER DUE TO PARTIAL S-MET INCORPORATION. 4. SULFATE IONS (SO4) FROM THE CRYSTALLIZATION BUFFER WERE MODELED INTO THE STRUCTURE. 5. THE ELECTRON DENSITIES FOR RESIDUES 134-164 ARE DISORDERED, AND THESE RESIDUES WERE NOT MODELED. ; _refine.ls_R_factor_obs 0.192 _refine.ls_R_factor_R_work 0.191 _refine.ls_R_factor_R_free 0.226 _refine.ls_percent_reflns_R_free 4.800 _refine.ls_number_reflns_R_free 424 _refine.B_iso_mean 42.729 _refine.aniso_B[1][1] -1.760 _refine.aniso_B[2][2] -1.760 _refine.aniso_B[3][3] 3.520 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.correlation_coeff_Fo_to_Fc 0.963 _refine.correlation_coeff_Fo_to_Fc_free 0.944 _refine.pdbx_overall_ESU_R 0.242 _refine.pdbx_overall_ESU_R_Free 0.203 _refine.overall_SU_ML 0.158 _refine.overall_SU_B 14.700 _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all ? _refine.ls_R_factor_all ? _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_starting_model ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1019 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 24 _refine_hist.number_atoms_total 1053 _refine_hist.d_res_high 2.500 _refine_hist.d_res_low 28.433 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 1048 0.015 0.022 ? 'X-RAY DIFFRACTION' ? r_bond_other_d 659 0.003 0.020 ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1428 1.645 1.936 ? 'X-RAY DIFFRACTION' ? r_angle_other_deg 1629 1.123 3.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 131 7.696 5.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 48 41.902 26.667 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 171 17.239 15.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 1 18.761 15.000 ? 'X-RAY DIFFRACTION' ? r_chiral_restr 161 0.094 0.200 ? 'X-RAY DIFFRACTION' ? r_gen_planes_refined 1168 0.006 0.020 ? 'X-RAY DIFFRACTION' ? r_gen_planes_other 189 0.002 0.020 ? 'X-RAY DIFFRACTION' ? r_nbd_refined 194 0.201 0.300 ? 'X-RAY DIFFRACTION' ? r_nbd_other 630 0.162 0.300 ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 477 0.178 0.500 ? 'X-RAY DIFFRACTION' ? r_nbtor_other 563 0.093 0.500 ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 59 0.167 0.500 ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 8 0.167 0.300 ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 33 0.160 0.300 ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 11 0.161 0.500 ? 'X-RAY DIFFRACTION' ? r_mcbond_it 717 1.941 3.000 ? 'X-RAY DIFFRACTION' ? r_mcbond_other 266 0.370 3.000 ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1061 3.094 5.000 ? 'X-RAY DIFFRACTION' ? r_scbond_it 440 5.367 8.000 ? 'X-RAY DIFFRACTION' ? r_scangle_it 367 7.797 11.000 ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.d_res_high 2.500 _refine_ls_shell.d_res_low 2.565 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 99.840 _refine_ls_shell.number_reflns_R_work 608 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.401 _refine_ls_shell.R_factor_R_free 0.471 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 27 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 635 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2RE7 _struct.title ;Crystal structure of a pyridoxamine 5'-phosphate oxidase related protein (psyc_0186) from psychrobacter arcticus 273-4 at 2.50 A resolution ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.text ;General stress protein cog3871, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, oxidoreductase ; _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.entry_id 2RE7 # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_biol.id 1 _struct_biol.details ;SIZE EXCLUSION CHROMATOGRAPHY SUPPORTS THE ASSIGNMENT OF A DIMER AS A SIGNIFICANT OLIGOMERIZATION STATE. ; # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 HIS A 7 ? VAL A 18 ? HIS A 6 VAL A 17 1 ? 12 HELX_P HELX_P2 2 SER A 57 ? ASP A 66 ? SER A 56 ASP A 65 1 ? 10 HELX_P HELX_P3 3 ASP A 93 ? TRP A 101 ? ASP A 92 TRP A 100 1 ? 9 HELX_P HELX_P4 4 SER A 102 ? PHE A 108 ? SER A 101 PHE A 107 1 ? 7 HELX_P HELX_P5 5 ASN A 111 ? ASP A 115 ? ASN A 110 ASP A 114 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ALA 21 C ? ? ? 1_555 A MSE 22 N ? ? A ALA 20 A MSE 21 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale2 covale both ? A MSE 22 C ? ? ? 1_555 A ILE 23 N ? ? A MSE 21 A ILE 22 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale3 covale both ? A PRO 36 C ? ? ? 1_555 A MSE 37 N ? ? A PRO 35 A MSE 36 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale4 covale both ? A MSE 37 C ? ? ? 1_555 A THR 38 N ? ? A MSE 36 A THR 37 1_555 ? ? ? ? ? ? ? 1.319 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 133 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 132 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 GLY _struct_mon_prot_cis.pdbx_label_seq_id_2 134 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 GLY _struct_mon_prot_cis.pdbx_auth_seq_id_2 133 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.88 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 32 ? MSE A 37 ? ILE A 31 MSE A 36 A 2 ALA A 21 ? SER A 26 ? ALA A 20 SER A 25 A 3 ARG A 68 ? ALA A 74 ? ARG A 67 ALA A 73 A 4 TYR A 81 ? GLU A 89 ? TYR A 80 GLU A 88 A 5 ILE A 118 ? TRP A 131 ? ILE A 117 TRP A 130 A 6 GLU A 48 ? ASP A 54 ? GLU A 47 ASP A 53 A 7 GLU A 41 ? ASN A 43 ? GLU A 40 ASN A 42 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O MSE A 37 ? O MSE A 36 N ALA A 21 ? N ALA A 20 A 2 3 N SER A 24 ? N SER A 23 O GLY A 70 ? O GLY A 69 A 3 4 N LEU A 71 ? N LEU A 70 O ILE A 84 ? O ILE A 83 A 4 5 N GLU A 89 ? N GLU A 88 O LYS A 122 ? O LYS A 121 A 5 6 O VAL A 123 ? O VAL A 122 N ILE A 49 ? N ILE A 48 A 6 7 O GLU A 48 ? O GLU A 47 N ASN A 43 ? N ASN A 42 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 134 ? 5 'BINDING SITE FOR RESIDUE SO4 A 134' AC2 Software A SO4 135 ? 6 'BINDING SITE FOR RESIDUE SO4 A 135' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 SER A 3 ? SER A 2 . ? 1_555 ? 2 AC1 5 HIS A 33 ? HIS A 32 . ? 6_555 ? 3 AC1 5 SER A 85 ? SER A 84 . ? 1_555 ? 4 AC1 5 HIS A 126 ? HIS A 125 . ? 1_555 ? 5 AC1 5 GLY A 127 ? GLY A 126 . ? 1_555 ? 6 AC2 6 SER A 3 ? SER A 2 . ? 1_555 ? 7 AC2 6 LYS A 47 ? LYS A 46 . ? 1_555 ? 8 AC2 6 PRO A 125 ? PRO A 124 . ? 1_555 ? 9 AC2 6 HIS A 126 ? HIS A 125 . ? 1_555 ? 10 AC2 6 GLY A 127 ? GLY A 126 . ? 1_555 ? 11 AC2 6 VAL A 128 ? VAL A 127 . ? 1_555 ? # _atom_sites.entry_id 2RE7 _atom_sites.fract_transf_matrix[1][1] 0.009428 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009428 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011466 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 ? ? ? A . n A 1 2 MSE 2 1 ? ? ? A . n A 1 3 SER 3 2 2 SER SER A . n A 1 4 ASN 4 3 3 ASN ASN A . n A 1 5 GLN 5 4 4 GLN GLN A . n A 1 6 LYS 6 5 5 LYS LYS A . n A 1 7 HIS 7 6 6 HIS HIS A . n A 1 8 ILE 8 7 7 ILE ILE A . n A 1 9 ASP 9 8 8 ASP ASP A . n A 1 10 LYS 10 9 9 LYS LYS A . n A 1 11 ILE 11 10 10 ILE ILE A . n A 1 12 GLN 12 11 11 GLN GLN A . n A 1 13 ALA 13 12 12 ALA ALA A . n A 1 14 VAL 14 13 13 VAL VAL A . n A 1 15 ILE 15 14 14 ILE ILE A . n A 1 16 LYS 16 15 15 LYS LYS A . n A 1 17 ASP 17 16 16 ASP ASP A . n A 1 18 VAL 18 17 17 VAL VAL A . n A 1 19 LYS 19 18 18 LYS LYS A . n A 1 20 PHE 20 19 19 PHE PHE A . n A 1 21 ALA 21 20 20 ALA ALA A . n A 1 22 MSE 22 21 21 MSE MSE A . n A 1 23 ILE 23 22 22 ILE ILE A . n A 1 24 SER 24 23 23 SER SER A . n A 1 25 THR 25 24 24 THR THR A . n A 1 26 SER 26 25 25 SER SER A . n A 1 27 ASN 27 26 26 ASN ASN A . n A 1 28 LYS 28 27 27 LYS LYS A . n A 1 29 LYS 29 28 28 LYS LYS A . n A 1 30 GLY 30 29 29 GLY GLY A . n A 1 31 ASP 31 30 30 ASP ASP A . n A 1 32 ILE 32 31 31 ILE ILE A . n A 1 33 HIS 33 32 32 HIS HIS A . n A 1 34 ALA 34 33 33 ALA ALA A . n A 1 35 TRP 35 34 34 TRP TRP A . n A 1 36 PRO 36 35 35 PRO PRO A . n A 1 37 MSE 37 36 36 MSE MSE A . n A 1 38 THR 38 37 37 THR THR A . n A 1 39 THR 39 38 38 THR THR A . n A 1 40 SER 40 39 39 SER SER A . n A 1 41 GLU 41 40 40 GLU GLU A . n A 1 42 VAL 42 41 41 VAL VAL A . n A 1 43 ASN 43 42 42 ASN ASN A . n A 1 44 LEU 44 43 43 LEU LEU A . n A 1 45 ASP 45 44 44 ASP ASP A . n A 1 46 ASN 46 45 45 ASN ASN A . n A 1 47 LYS 47 46 46 LYS LYS A . n A 1 48 GLU 48 47 47 GLU GLU A . n A 1 49 ILE 49 48 48 ILE ILE A . n A 1 50 TRP 50 49 49 TRP TRP A . n A 1 51 PHE 51 50 50 PHE PHE A . n A 1 52 ILE 52 51 51 ILE ILE A . n A 1 53 GLY 53 52 52 GLY GLY A . n A 1 54 ASP 54 53 53 ASP ASP A . n A 1 55 LYS 55 54 54 LYS LYS A . n A 1 56 THR 56 55 55 THR THR A . n A 1 57 SER 57 56 56 SER SER A . n A 1 58 ASP 58 57 57 ASP ASP A . n A 1 59 VAL 59 58 58 VAL VAL A . n A 1 60 VAL 60 59 59 VAL VAL A . n A 1 61 LYS 61 60 60 LYS LYS A . n A 1 62 ASP 62 61 61 ASP ASP A . n A 1 63 ILE 63 62 62 ILE ILE A . n A 1 64 GLN 64 63 63 GLN GLN A . n A 1 65 ASP 65 64 64 ASP ASP A . n A 1 66 ASP 66 65 65 ASP ASP A . n A 1 67 ALA 67 66 66 ALA ALA A . n A 1 68 ARG 68 67 67 ARG ARG A . n A 1 69 ILE 69 68 68 ILE ILE A . n A 1 70 GLY 70 69 69 GLY GLY A . n A 1 71 LEU 71 70 70 LEU LEU A . n A 1 72 THR 72 71 71 THR THR A . n A 1 73 TYR 73 72 72 TYR TYR A . n A 1 74 ALA 74 73 73 ALA ALA A . n A 1 75 THR 75 74 74 THR THR A . n A 1 76 GLN 76 75 75 GLN GLN A . n A 1 77 ASP 77 76 76 ASP ASP A . n A 1 78 GLU 78 77 77 GLU GLU A . n A 1 79 LYS 79 78 78 LYS LYS A . n A 1 80 ASN 80 79 79 ASN ASN A . n A 1 81 TYR 81 80 80 TYR TYR A . n A 1 82 VAL 82 81 81 VAL VAL A . n A 1 83 SER 83 82 82 SER SER A . n A 1 84 ILE 84 83 83 ILE ILE A . n A 1 85 SER 85 84 84 SER SER A . n A 1 86 GLY 86 85 85 GLY GLY A . n A 1 87 ASP 87 86 86 ASP ASP A . n A 1 88 ALA 88 87 87 ALA ALA A . n A 1 89 GLU 89 88 88 GLU GLU A . n A 1 90 LEU 90 89 89 LEU LEU A . n A 1 91 PRO 91 90 90 PRO PRO A . n A 1 92 THR 92 91 91 THR THR A . n A 1 93 ASP 93 92 92 ASP ASP A . n A 1 94 LYS 94 93 93 LYS LYS A . n A 1 95 ALA 95 94 94 ALA ALA A . n A 1 96 LYS 96 95 95 LYS LYS A . n A 1 97 LEU 97 96 96 LEU LEU A . n A 1 98 ASP 98 97 97 ASP ASP A . n A 1 99 GLU 99 98 98 GLU GLU A . n A 1 100 LEU 100 99 99 LEU LEU A . n A 1 101 TRP 101 100 100 TRP TRP A . n A 1 102 SER 102 101 101 SER SER A . n A 1 103 PRO 103 102 102 PRO PRO A . n A 1 104 VAL 104 103 103 VAL VAL A . n A 1 105 TYR 105 104 104 TYR TYR A . n A 1 106 SER 106 105 105 SER SER A . n A 1 107 ALA 107 106 106 ALA ALA A . n A 1 108 PHE 108 107 107 PHE PHE A . n A 1 109 PHE 109 108 108 PHE PHE A . n A 1 110 ALA 110 109 109 ALA ALA A . n A 1 111 ASN 111 110 110 ASN ASN A . n A 1 112 GLY 112 111 111 GLY GLY A . n A 1 113 LYS 113 112 112 LYS LYS A . n A 1 114 GLU 114 113 113 GLU GLU A . n A 1 115 ASP 115 114 114 ASP ASP A . n A 1 116 ALA 116 115 115 ALA ALA A . n A 1 117 ASN 117 116 116 ASN ASN A . n A 1 118 ILE 118 117 117 ILE ILE A . n A 1 119 GLN 119 118 118 GLN GLN A . n A 1 120 LEU 120 119 119 LEU LEU A . n A 1 121 ILE 121 120 120 ILE ILE A . n A 1 122 LYS 122 121 121 LYS LYS A . n A 1 123 VAL 123 122 122 VAL VAL A . n A 1 124 VAL 124 123 123 VAL VAL A . n A 1 125 PRO 125 124 124 PRO PRO A . n A 1 126 HIS 126 125 125 HIS HIS A . n A 1 127 GLY 127 126 126 GLY GLY A . n A 1 128 VAL 128 127 127 VAL VAL A . n A 1 129 GLU 129 128 128 GLU GLU A . n A 1 130 CYS 130 129 129 CYS CYS A . n A 1 131 TRP 131 130 130 TRP TRP A . n A 1 132 LEU 132 131 131 LEU LEU A . n A 1 133 SER 133 132 132 SER SER A . n A 1 134 GLY 134 133 133 GLY GLY A . n # _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Joint Center for Structural Genomics' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center JCSG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 134 1 SO4 SO4 A . C 2 SO4 1 135 2 SO4 SO4 A . D 3 HOH 1 136 3 HOH HOH A . D 3 HOH 2 137 4 HOH HOH A . D 3 HOH 3 138 5 HOH HOH A . D 3 HOH 4 139 6 HOH HOH A . D 3 HOH 5 140 7 HOH HOH A . D 3 HOH 6 141 8 HOH HOH A . D 3 HOH 7 142 9 HOH HOH A . D 3 HOH 8 143 10 HOH HOH A . D 3 HOH 9 144 11 HOH HOH A . D 3 HOH 10 145 12 HOH HOH A . D 3 HOH 11 146 13 HOH HOH A . D 3 HOH 12 147 14 HOH HOH A . D 3 HOH 13 148 15 HOH HOH A . D 3 HOH 14 149 16 HOH HOH A . D 3 HOH 15 150 17 HOH HOH A . D 3 HOH 16 151 18 HOH HOH A . D 3 HOH 17 152 19 HOH HOH A . D 3 HOH 18 153 20 HOH HOH A . D 3 HOH 19 154 21 HOH HOH A . D 3 HOH 20 155 22 HOH HOH A . D 3 HOH 21 156 23 HOH HOH A . D 3 HOH 22 157 24 HOH HOH A . D 3 HOH 23 158 25 HOH HOH A . D 3 HOH 24 159 26 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 22 A MSE 21 ? MET SELENOMETHIONINE 2 A MSE 37 A MSE 36 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_prop.biol_id 1 _pdbx_struct_assembly_prop.type 'ABSA (A^2)' _pdbx_struct_assembly_prop.value 2390 _pdbx_struct_assembly_prop.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_555 x,-y+1/2,-z+1/4 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 53.0315000000 0.0000000000 0.0000000000 -1.0000000000 21.8045000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 147 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-09 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-10-25 4 'Structure model' 1 3 2019-07-24 5 'Structure model' 1 4 2023-01-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Source and taxonomy' 3 2 'Structure model' 'Version format compliance' 4 3 'Structure model' 'Author supporting evidence' 5 3 'Structure model' 'Refinement description' 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Derived calculations' 8 4 'Structure model' 'Refinement description' 9 5 'Structure model' 'Database references' 10 5 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_struct_assembly_auth_evidence 2 3 'Structure model' software 3 4 'Structure model' software 4 4 'Structure model' struct_conn 5 5 'Structure model' database_2 6 5 'Structure model' struct_ref_seq_dif 7 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_software.classification' 2 3 'Structure model' '_software.name' 3 4 'Structure model' '_software.classification' 4 4 'Structure model' '_software.contact_author' 5 4 'Structure model' '_software.contact_author_email' 6 4 'Structure model' '_software.language' 7 4 'Structure model' '_software.location' 8 4 'Structure model' '_software.name' 9 4 'Structure model' '_software.type' 10 4 'Structure model' '_software.version' 11 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 12 5 'Structure model' '_database_2.pdbx_DOI' 13 5 'Structure model' '_database_2.pdbx_database_accession' 14 5 'Structure model' '_struct_ref_seq_dif.details' 15 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 16 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 17 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 51.1702 _pdbx_refine_tls.origin_y 22.5969 _pdbx_refine_tls.origin_z 22.1508 _pdbx_refine_tls.T[1][1] 0.0415 _pdbx_refine_tls.T[2][2] -0.0125 _pdbx_refine_tls.T[3][3] 0.0183 _pdbx_refine_tls.T[1][2] -0.0450 _pdbx_refine_tls.T[1][3] 0.0593 _pdbx_refine_tls.T[2][3] 0.0116 _pdbx_refine_tls.L[1][1] 3.0044 _pdbx_refine_tls.L[2][2] 6.0234 _pdbx_refine_tls.L[3][3] 4.2878 _pdbx_refine_tls.L[1][2] -0.9888 _pdbx_refine_tls.L[1][3] 1.5357 _pdbx_refine_tls.L[2][3] -3.2598 _pdbx_refine_tls.S[1][1] 0.0878 _pdbx_refine_tls.S[2][2] -0.0701 _pdbx_refine_tls.S[3][3] -0.0177 _pdbx_refine_tls.S[1][2] -0.3171 _pdbx_refine_tls.S[1][3] 0.2560 _pdbx_refine_tls.S[2][3] 0.3111 _pdbx_refine_tls.S[2][1] 0.7177 _pdbx_refine_tls.S[3][1] -0.5163 _pdbx_refine_tls.S[3][2] -0.0612 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 3 _pdbx_refine_tls_group.end_label_asym_id A _pdbx_refine_tls_group.end_label_seq_id 134 _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 2 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 133 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.selection_details ? # _phasing.method MAD # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal REFMAC 5.2.0019 ? program 'Murshudov, G.N.' ccp4@dl.ac.uk refinement http://www.ccp4.ac.uk/main.html Fortran_77 ? 1 PHENIX . ? package 'P.D. Adams' PDAdams@lbl.gov refinement http://www.phenix-online.org/ C++ ? 2 SHELX . ? package 'George Sheldrick' gsheldr@shelx.uni-ac.gwdg.de phasing http://shelx.uni-ac.gwdg.de/SHELX/ Fortran_77 ? 3 MolProbity 3beta29 ? package 'D.C. & J.S. Richardson lab' molprobity@kinemage.biochem.duke.edu 'model building' http://kinemage.biochem.duke.edu/molprobity/ ? ? 4 SCALA . ? other 'Phil Evans' pre@mrc-lmb.cam.ac.uk 'data scaling' http://www.ccp4.ac.uk/dist/html/INDEX.html Fortran_77 ? 5 PDB_EXTRACT 3.000 'July 2, 2007' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 6 MAR345 CCD ? ? ? ? 'data collection' ? ? ? 7 MOSFLM . ? ? ? ? 'data reduction' ? ? ? 8 SHELXD . ? ? ? ? phasing ? ? ? 9 # loop_ _pdbx_database_remark.id _pdbx_database_remark.text 300 ; BIOMOLECULE: 1, 2 SEE REMARK 350 FOR THE AUTHOR PROVIDED AND PROGRAM GENERATED ASSEMBLY INFORMATION FOR THE STRUCTURE IN THIS ENTRY. THE REMARK MAY ALSO PROVIDE INFORMATION ON BURIED SURFACE AREA. SIZE EXCLUSION CHROMATOGRAPHY SUPPORTS THE ASSIGNMENT OF A DIMER AS A SIGNIFICANT OLIGOMERIZATION STATE. ; 999 ; SEQUENCE THE CONSTRUCT WAS EXPRESSED WITH A PURIFICATION TAG MGSDKIHHHHHHENLYFQG. THE TAG WAS REMOVED WITH TEV PROTEASE LEAVING ONLY A GLYCINE FOLLOWED BY THE TARGET SEQUENCE. ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 46 ? ? 60.26 67.67 2 1 LEU A 89 ? ? -119.89 67.18 3 1 ALA A 106 ? ? -61.79 -73.37 4 1 PHE A 108 ? ? -163.33 99.92 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 LYS _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 5 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 HIS _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 6 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 136.95 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 5 ? CG ? A LYS 6 CG 2 1 Y 1 A LYS 5 ? CD ? A LYS 6 CD 3 1 Y 1 A LYS 5 ? CE ? A LYS 6 CE 4 1 Y 1 A LYS 5 ? NZ ? A LYS 6 NZ 5 1 Y 1 A LYS 9 ? CD ? A LYS 10 CD 6 1 Y 1 A LYS 9 ? CE ? A LYS 10 CE 7 1 Y 1 A LYS 9 ? NZ ? A LYS 10 NZ 8 1 Y 1 A LYS 15 ? CG ? A LYS 16 CG 9 1 Y 1 A LYS 15 ? CD ? A LYS 16 CD 10 1 Y 1 A LYS 15 ? CE ? A LYS 16 CE 11 1 Y 1 A LYS 15 ? NZ ? A LYS 16 NZ 12 1 Y 1 A LYS 27 ? CD ? A LYS 28 CD 13 1 Y 1 A LYS 27 ? CE ? A LYS 28 CE 14 1 Y 1 A LYS 27 ? NZ ? A LYS 28 NZ 15 1 Y 1 A LYS 78 ? CE ? A LYS 79 CE 16 1 Y 1 A LYS 78 ? NZ ? A LYS 79 NZ 17 1 Y 1 A LYS 93 ? CD ? A LYS 94 CD 18 1 Y 1 A LYS 93 ? CE ? A LYS 94 CE 19 1 Y 1 A LYS 93 ? NZ ? A LYS 94 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 0 ? A GLY 1 2 1 Y 1 A MSE 1 ? A MSE 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #