data_2RO4 # _entry.id 2RO4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2RO4 pdb_00002ro4 10.2210/pdb2ro4/pdb RCSB RCSB150082 ? ? WWPDB D_1000150082 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-11-11 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2012-01-11 4 'Structure model' 1 3 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2RO4 _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2008-03-08 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.content_type 1Z0R PDB 'Solution Structure of the N-terminal DNA Recognition Domain of the Bacillus subtilis Transition-state Regulator AbrB' unspecified 2FY9 PDB 'Solution Structure of the N-terminal DNA Recognition Domain of the Bacillus subtilis Transition-state Regulator Abh' unspecified 2RO3 PDB . unspecified 2RO5 PDB . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sullivan, D.M.' 1 'Bobay, B.G.' 2 'Kojetin, D.J.' 3 'Thompson, R.J.' 4 'Rance, M.' 5 'Strauch, M.A.' 6 'Cavanagh, J.' 7 # _citation.id primary _citation.title 'Insights into the nature of DNA binding of AbrB-like transcription factors' _citation.journal_abbrev Structure _citation.journal_volume 16 _citation.page_first 1702 _citation.page_last 1713 _citation.year 2008 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19000822 _citation.pdbx_database_id_DOI 10.1016/j.str.2008.08.014 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sullivan, D.M.' 1 ? primary 'Bobay, B.G.' 2 ? primary 'Kojetin, D.J.' 3 ? primary 'Thompson, R.J.' 4 ? primary 'Rance, M.' 5 ? primary 'Strauch, M.A.' 6 ? primary 'Cavanagh, J.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Transition state regulatory protein abrB' _entity.formula_weight 6111.287 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-terminal DNA Recognition Domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMT _entity_poly.pdbx_seq_one_letter_code_can MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMT _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 SER n 1 4 THR n 1 5 GLY n 1 6 ILE n 1 7 VAL n 1 8 ARG n 1 9 LYS n 1 10 VAL n 1 11 ASP n 1 12 GLU n 1 13 LEU n 1 14 GLY n 1 15 ARG n 1 16 VAL n 1 17 VAL n 1 18 ILE n 1 19 PRO n 1 20 ILE n 1 21 GLU n 1 22 LEU n 1 23 ARG n 1 24 ARG n 1 25 THR n 1 26 LEU n 1 27 GLY n 1 28 ILE n 1 29 ALA n 1 30 GLU n 1 31 LYS n 1 32 ASP n 1 33 ALA n 1 34 LEU n 1 35 GLU n 1 36 ILE n 1 37 TYR n 1 38 VAL n 1 39 ASP n 1 40 ASP n 1 41 GLU n 1 42 LYS n 1 43 ILE n 1 44 ILE n 1 45 LEU n 1 46 LYS n 1 47 LYS n 1 48 TYR n 1 49 LYS n 1 50 PRO n 1 51 ASN n 1 52 MET n 1 53 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene abrB _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1423 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET24 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 MET 52 52 52 MET MET A . n A 1 53 THR 53 53 53 THR THR A . n B 1 1 MET 1 1 1 MET MET B . n B 1 2 LYS 2 2 2 LYS LYS B . n B 1 3 SER 3 3 3 SER SER B . n B 1 4 THR 4 4 4 THR THR B . n B 1 5 GLY 5 5 5 GLY GLY B . n B 1 6 ILE 6 6 6 ILE ILE B . n B 1 7 VAL 7 7 7 VAL VAL B . n B 1 8 ARG 8 8 8 ARG ARG B . n B 1 9 LYS 9 9 9 LYS LYS B . n B 1 10 VAL 10 10 10 VAL VAL B . n B 1 11 ASP 11 11 11 ASP ASP B . n B 1 12 GLU 12 12 12 GLU GLU B . n B 1 13 LEU 13 13 13 LEU LEU B . n B 1 14 GLY 14 14 14 GLY GLY B . n B 1 15 ARG 15 15 15 ARG ARG B . n B 1 16 VAL 16 16 16 VAL VAL B . n B 1 17 VAL 17 17 17 VAL VAL B . n B 1 18 ILE 18 18 18 ILE ILE B . n B 1 19 PRO 19 19 19 PRO PRO B . n B 1 20 ILE 20 20 20 ILE ILE B . n B 1 21 GLU 21 21 21 GLU GLU B . n B 1 22 LEU 22 22 22 LEU LEU B . n B 1 23 ARG 23 23 23 ARG ARG B . n B 1 24 ARG 24 24 24 ARG ARG B . n B 1 25 THR 25 25 25 THR THR B . n B 1 26 LEU 26 26 26 LEU LEU B . n B 1 27 GLY 27 27 27 GLY GLY B . n B 1 28 ILE 28 28 28 ILE ILE B . n B 1 29 ALA 29 29 29 ALA ALA B . n B 1 30 GLU 30 30 30 GLU GLU B . n B 1 31 LYS 31 31 31 LYS LYS B . n B 1 32 ASP 32 32 32 ASP ASP B . n B 1 33 ALA 33 33 33 ALA ALA B . n B 1 34 LEU 34 34 34 LEU LEU B . n B 1 35 GLU 35 35 35 GLU GLU B . n B 1 36 ILE 36 36 36 ILE ILE B . n B 1 37 TYR 37 37 37 TYR TYR B . n B 1 38 VAL 38 38 38 VAL VAL B . n B 1 39 ASP 39 39 39 ASP ASP B . n B 1 40 ASP 40 40 40 ASP ASP B . n B 1 41 GLU 41 41 41 GLU GLU B . n B 1 42 LYS 42 42 42 LYS LYS B . n B 1 43 ILE 43 43 43 ILE ILE B . n B 1 44 ILE 44 44 44 ILE ILE B . n B 1 45 LEU 45 45 45 LEU LEU B . n B 1 46 LYS 46 46 46 LYS LYS B . n B 1 47 LYS 47 47 47 LYS LYS B . n B 1 48 TYR 48 48 48 TYR TYR B . n B 1 49 LYS 49 49 49 LYS LYS B . n B 1 50 PRO 50 50 50 PRO PRO B . n B 1 51 ASN 51 51 51 ASN ASN B . n B 1 52 MET 52 52 52 MET MET B . n B 1 53 THR 53 53 53 THR THR B . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'RDC-refined structure of ABrBN' _exptl.entry_id 2RO4 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2RO4 _struct.title 'RDC-refined Solution Structure of the N-terminal DNA Recognition Domain of the Bacillus subtilis Transition-state Regulator AbrB' _struct.pdbx_model_details 'RDC-refined structure of ABrBN' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2RO4 _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'Transcription, Activator, DNA-binding, Repressor, Sporulation, Transcription regulation' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ABRB_BACSU _struct_ref.pdbx_db_accession P08874 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMT _struct_ref.pdbx_align_begin 3 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2RO4 A 1 ? 53 ? P08874 3 ? 55 ? 1 53 2 1 2RO4 B 1 ? 53 ? P08874 3 ? 55 ? 1 53 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 19 ? GLY A 27 ? PRO A 19 GLY A 27 1 ? 9 HELX_P HELX_P2 2 PRO B 19 ? GLY B 27 ? PRO B 19 GLY B 27 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 6 ? LYS A 9 ? ILE A 6 LYS A 9 A 2 ALA B 33 ? ASP B 39 ? ALA B 33 ASP B 39 A 3 LYS B 42 ? LYS B 47 ? LYS B 42 LYS B 47 A 4 LYS A 42 ? LYS A 47 ? LYS A 42 LYS A 47 A 5 ALA A 33 ? ASP A 39 ? ALA A 33 ASP A 39 A 6 ILE B 6 ? LYS B 9 ? ILE B 6 LYS B 9 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 6 ? N ILE A 6 O ILE B 36 ? O ILE B 36 A 2 3 N TYR B 37 ? N TYR B 37 O ILE B 44 ? O ILE B 44 A 3 4 O LEU B 45 ? O LEU B 45 N ILE A 43 ? N ILE A 43 A 4 5 O ILE A 44 ? O ILE A 44 N TYR A 37 ? N TYR A 37 A 5 6 N ILE A 36 ? N ILE A 36 O ILE B 6 ? O ILE B 6 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HG3 A LYS 2 ? ? H A SER 3 ? ? 1.24 2 1 OD2 A ASP 39 ? ? HZ3 A LYS 42 ? ? 1.57 3 3 HG3 B LYS 2 ? ? H B SER 3 ? ? 1.15 4 3 HG3 A LYS 2 ? ? H A SER 3 ? ? 1.27 5 4 HG3 A LYS 2 ? ? H A SER 3 ? ? 1.21 6 4 HG3 B LYS 2 ? ? H B SER 3 ? ? 1.24 7 5 HD12 A ILE 20 ? ? HD2 A ARG 23 ? ? 1.35 8 9 HG13 B ILE 36 ? ? HD22 B LEU 45 ? ? 1.20 9 9 HD11 A LEU 45 ? ? HD11 B LEU 45 ? ? 1.25 10 9 HG13 A ILE 36 ? ? HD22 A LEU 45 ? ? 1.28 11 10 HG13 A ILE 36 ? ? HD13 A LEU 45 ? ? 1.34 12 10 HG13 B ILE 36 ? ? HD12 B LEU 45 ? ? 1.35 13 10 OD2 A ASP 39 ? ? HZ1 A LYS 42 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 2 ? ? -131.26 -85.60 2 1 THR A 4 ? ? 63.32 75.41 3 1 VAL A 10 ? ? -85.05 -108.83 4 1 ASP A 11 ? ? 177.26 -74.65 5 1 GLU A 12 ? ? -161.57 -80.55 6 1 ARG A 15 ? ? -53.36 103.09 7 1 GLU A 30 ? ? 32.40 -89.47 8 1 ASP A 40 ? ? 55.26 -80.73 9 1 LYS B 2 ? ? -103.04 -163.77 10 1 SER B 3 ? ? -67.31 -177.67 11 1 THR B 4 ? ? 78.79 72.61 12 1 VAL B 10 ? ? -86.16 -103.05 13 1 ASP B 11 ? ? 172.91 -76.10 14 1 GLU B 12 ? ? -166.65 -76.80 15 1 ARG B 15 ? ? -56.17 99.93 16 1 GLU B 30 ? ? 34.65 -87.30 17 1 ASP B 40 ? ? 61.19 -85.92 18 2 LYS A 2 ? ? 69.90 144.60 19 2 SER A 3 ? ? -72.54 -163.59 20 2 VAL A 10 ? ? -82.93 -143.43 21 2 ASP A 11 ? ? -153.96 -62.50 22 2 GLU A 12 ? ? -157.20 -85.34 23 2 ARG A 15 ? ? -52.90 106.41 24 2 GLU A 30 ? ? 31.05 -89.40 25 2 ASP A 40 ? ? 56.88 -96.45 26 2 LYS B 2 ? ? 73.61 148.16 27 2 SER B 3 ? ? -72.24 -165.64 28 2 THR B 4 ? ? 69.59 63.94 29 2 VAL B 10 ? ? -82.85 -117.32 30 2 ASP B 11 ? ? -178.25 -67.23 31 2 GLU B 12 ? ? -161.18 -84.48 32 2 ARG B 15 ? ? -54.65 104.85 33 2 GLU B 30 ? ? 36.11 -86.76 34 2 ASP B 40 ? ? 60.99 -91.28 35 3 LYS A 2 ? ? -118.04 -81.33 36 3 VAL A 10 ? ? -85.08 -133.32 37 3 ASP A 11 ? ? -162.92 -67.67 38 3 GLU A 12 ? ? -140.90 -94.34 39 3 ARG A 15 ? ? -58.56 104.94 40 3 ALA A 29 ? ? -177.45 146.87 41 3 GLU A 30 ? ? 35.00 -89.67 42 3 ASP A 40 ? ? 55.80 -90.56 43 3 LYS B 2 ? ? -108.69 -83.42 44 3 THR B 4 ? ? 62.84 63.26 45 3 VAL B 10 ? ? -82.36 -133.91 46 3 ASP B 11 ? ? -177.95 -51.47 47 3 GLU B 12 ? ? -125.32 -124.85 48 3 ARG B 15 ? ? -58.96 100.24 49 3 GLU B 30 ? ? 36.15 -89.60 50 3 ASP B 40 ? ? 64.17 -97.77 51 4 LYS A 2 ? ? -93.61 -84.28 52 4 THR A 4 ? ? 66.85 69.39 53 4 VAL A 10 ? ? -86.77 -132.86 54 4 ASP A 11 ? ? -159.60 -66.14 55 4 GLU A 12 ? ? -153.47 -84.70 56 4 ARG A 15 ? ? -66.13 99.66 57 4 ALA A 29 ? ? 179.67 157.31 58 4 GLU A 30 ? ? 35.22 -90.22 59 4 ASP A 40 ? ? 64.71 -97.48 60 4 LYS B 2 ? ? -71.54 -85.58 61 4 THR B 4 ? ? 64.78 67.07 62 4 VAL B 10 ? ? -86.42 -108.50 63 4 ASP B 11 ? ? 173.11 -68.97 64 4 GLU B 12 ? ? -166.56 -85.82 65 4 ARG B 15 ? ? -65.67 97.61 66 4 GLU B 30 ? ? 39.65 -92.38 67 4 ASP B 40 ? ? 60.42 -90.36 68 5 SER A 3 ? ? -73.39 -162.40 69 5 THR A 4 ? ? 65.88 65.26 70 5 VAL A 10 ? ? -82.58 -136.51 71 5 ASP A 11 ? ? -155.60 -66.01 72 5 GLU A 12 ? ? -156.01 -82.82 73 5 ARG A 15 ? ? -53.96 104.39 74 5 ALA A 29 ? ? -174.97 148.96 75 5 GLU A 30 ? ? 33.07 -89.69 76 5 ASP A 40 ? ? 54.03 -79.51 77 5 SER B 3 ? ? -70.79 -162.53 78 5 VAL B 10 ? ? -82.34 -108.02 79 5 ASP B 11 ? ? 175.17 -77.80 80 5 GLU B 12 ? ? -159.27 -71.61 81 5 ARG B 15 ? ? -56.61 99.94 82 5 GLU B 30 ? ? 33.78 -90.67 83 5 ASP B 40 ? ? 56.14 -75.95 84 6 THR A 4 ? ? 72.15 72.59 85 6 VAL A 10 ? ? -79.35 -102.46 86 6 ASP A 11 ? ? 174.48 -73.01 87 6 GLU A 12 ? ? -164.78 -80.70 88 6 ARG A 15 ? ? -49.49 105.80 89 6 ALA A 29 ? ? -176.38 146.39 90 6 GLU A 30 ? ? 37.50 -85.08 91 6 ASP A 40 ? ? 61.94 -77.38 92 6 PRO A 50 ? ? -59.50 107.02 93 6 THR B 4 ? ? 74.16 71.36 94 6 VAL B 10 ? ? -78.99 -103.74 95 6 ASP B 11 ? ? 175.42 -77.01 96 6 GLU B 12 ? ? -160.57 -73.25 97 6 ARG B 15 ? ? -50.12 105.03 98 6 GLU B 30 ? ? 36.20 -89.97 99 6 ASP B 40 ? ? 63.88 -81.07 100 7 LYS A 2 ? ? -119.29 -158.68 101 7 SER A 3 ? ? -66.20 -175.41 102 7 THR A 4 ? ? 72.11 67.74 103 7 VAL A 10 ? ? -86.75 -109.64 104 7 ASP A 11 ? ? 179.11 -67.30 105 7 GLU A 12 ? ? -168.15 -83.83 106 7 ARG A 15 ? ? -58.12 106.82 107 7 GLU A 30 ? ? 37.83 -89.71 108 7 ASP A 40 ? ? 63.17 -85.24 109 7 LYS B 2 ? ? -89.36 -95.42 110 7 THR B 4 ? ? 65.73 69.30 111 7 VAL B 10 ? ? -84.30 -118.10 112 7 ASP B 11 ? ? -171.91 -63.58 113 7 GLU B 12 ? ? -169.59 -86.89 114 7 ALA B 29 ? ? -179.44 146.66 115 7 GLU B 30 ? ? 37.47 -89.59 116 7 ASP B 40 ? ? 62.71 -77.70 117 8 SER A 3 ? ? -72.79 -167.65 118 8 THR A 4 ? ? 71.73 60.58 119 8 VAL A 10 ? ? -82.05 -118.28 120 8 ASP A 11 ? ? -174.79 -69.30 121 8 GLU A 12 ? ? -154.98 -78.52 122 8 ARG A 15 ? ? -53.49 106.41 123 8 GLU A 30 ? ? 35.12 -89.97 124 8 ASP A 40 ? ? 57.79 -76.99 125 8 SER B 3 ? ? -69.36 -166.05 126 8 THR B 4 ? ? 66.82 66.16 127 8 VAL B 10 ? ? -81.06 -109.16 128 8 ASP B 11 ? ? 176.65 -79.00 129 8 GLU B 12 ? ? -154.92 -81.85 130 8 ARG B 15 ? ? -54.90 105.18 131 8 GLU B 30 ? ? 36.00 -89.56 132 8 ASP B 40 ? ? 60.02 -75.55 133 8 PRO B 50 ? ? -66.56 98.83 134 9 THR A 4 ? ? 72.00 71.60 135 9 VAL A 10 ? ? -80.21 -108.07 136 9 ASP A 11 ? ? 175.26 -67.29 137 9 GLU A 12 ? ? -158.47 -86.91 138 9 ARG A 15 ? ? -66.81 99.65 139 9 GLU A 30 ? ? 37.82 -89.46 140 9 ASP A 40 ? ? 58.55 -82.61 141 9 SER B 3 ? ? -79.47 -167.26 142 9 THR B 4 ? ? 71.94 70.58 143 9 VAL B 10 ? ? -76.73 -104.48 144 9 ASP B 11 ? ? 170.20 -71.04 145 9 GLU B 12 ? ? -154.45 -83.51 146 9 ARG B 15 ? ? -66.77 96.98 147 9 GLU B 30 ? ? 34.36 -90.13 148 9 ASP B 40 ? ? 57.02 -87.53 149 10 LYS A 2 ? ? -97.61 -152.36 150 10 SER A 3 ? ? -68.47 -170.44 151 10 THR A 4 ? ? 70.79 68.22 152 10 VAL A 10 ? ? -78.61 -105.91 153 10 ASP A 11 ? ? 175.32 -78.03 154 10 GLU A 12 ? ? -161.59 -77.71 155 10 ARG A 15 ? ? -51.92 104.87 156 10 GLU A 30 ? ? 37.65 -89.30 157 10 ASP A 40 ? ? 63.53 -83.13 158 10 LYS B 2 ? ? -124.76 -84.26 159 10 THR B 4 ? ? 64.68 70.52 160 10 VAL B 10 ? ? -78.24 -111.26 161 10 ASP B 11 ? ? 179.88 -68.94 162 10 GLU B 12 ? ? -160.38 -83.97 163 10 ALA B 29 ? ? -177.85 148.67 164 10 GLU B 30 ? ? 35.85 -87.23 165 10 ASP B 40 ? ? 58.56 -79.16 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 10 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2RO4 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2RO4 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '20mM potassium phosphate, 15mM potassium chloride, 1mM EDTA, 1mM DTT, 0.02% sodium azide, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'potassium phosphate' 20 mM ? 1 'potassium chloride' 15 mM ? 1 EDTA 1 mM ? 1 DTT 1 mM ? 1 'sodium azide' 0.02 % ? 1 'potassium phosphate' 20 mM ? 2 'potassium chloride' 15 mM ? 2 EDTA 1 mM ? 2 DTT 1 mM ? 2 'sodium azide' 0.02 % ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 15 _pdbx_nmr_exptl_sample_conditions.pH 5.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 305 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-15N IPAP HSQC' # _pdbx_nmr_details.entry_id 2RO4 _pdbx_nmr_details.text 'Experiments to measure residual dipolar couplings were collected and used to refine the previously released structure of AbrBN' # _pdbx_nmr_refine.entry_id 2RO4 _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ;The structures are based on 3090 NOE-derived distance constraints, 48 hydrogen bonds, 140 dihedral angle restraints, and 48 residual dipolar couplings restraints ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal ;Linge, O'Donoghue and Nilges ; 'data analysis' ARIA 1.2 1 ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA 1.2 2 'Johnson, One Moon Scientific' 'data analysis' NMRView 5.0 3 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'data analysis' NMRPipe ? 4 ;Linge, O'Donoghue and Nilges ; refinement ARIA 1.2 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLU N N N N 74 GLU CA C N S 75 GLU C C N N 76 GLU O O N N 77 GLU CB C N N 78 GLU CG C N N 79 GLU CD C N N 80 GLU OE1 O N N 81 GLU OE2 O N N 82 GLU OXT O N N 83 GLU H H N N 84 GLU H2 H N N 85 GLU HA H N N 86 GLU HB2 H N N 87 GLU HB3 H N N 88 GLU HG2 H N N 89 GLU HG3 H N N 90 GLU HE2 H N N 91 GLU HXT H N N 92 GLY N N N N 93 GLY CA C N N 94 GLY C C N N 95 GLY O O N N 96 GLY OXT O N N 97 GLY H H N N 98 GLY H2 H N N 99 GLY HA2 H N N 100 GLY HA3 H N N 101 GLY HXT H N N 102 ILE N N N N 103 ILE CA C N S 104 ILE C C N N 105 ILE O O N N 106 ILE CB C N S 107 ILE CG1 C N N 108 ILE CG2 C N N 109 ILE CD1 C N N 110 ILE OXT O N N 111 ILE H H N N 112 ILE H2 H N N 113 ILE HA H N N 114 ILE HB H N N 115 ILE HG12 H N N 116 ILE HG13 H N N 117 ILE HG21 H N N 118 ILE HG22 H N N 119 ILE HG23 H N N 120 ILE HD11 H N N 121 ILE HD12 H N N 122 ILE HD13 H N N 123 ILE HXT H N N 124 LEU N N N N 125 LEU CA C N S 126 LEU C C N N 127 LEU O O N N 128 LEU CB C N N 129 LEU CG C N N 130 LEU CD1 C N N 131 LEU CD2 C N N 132 LEU OXT O N N 133 LEU H H N N 134 LEU H2 H N N 135 LEU HA H N N 136 LEU HB2 H N N 137 LEU HB3 H N N 138 LEU HG H N N 139 LEU HD11 H N N 140 LEU HD12 H N N 141 LEU HD13 H N N 142 LEU HD21 H N N 143 LEU HD22 H N N 144 LEU HD23 H N N 145 LEU HXT H N N 146 LYS N N N N 147 LYS CA C N S 148 LYS C C N N 149 LYS O O N N 150 LYS CB C N N 151 LYS CG C N N 152 LYS CD C N N 153 LYS CE C N N 154 LYS NZ N N N 155 LYS OXT O N N 156 LYS H H N N 157 LYS H2 H N N 158 LYS HA H N N 159 LYS HB2 H N N 160 LYS HB3 H N N 161 LYS HG2 H N N 162 LYS HG3 H N N 163 LYS HD2 H N N 164 LYS HD3 H N N 165 LYS HE2 H N N 166 LYS HE3 H N N 167 LYS HZ1 H N N 168 LYS HZ2 H N N 169 LYS HZ3 H N N 170 LYS HXT H N N 171 MET N N N N 172 MET CA C N S 173 MET C C N N 174 MET O O N N 175 MET CB C N N 176 MET CG C N N 177 MET SD S N N 178 MET CE C N N 179 MET OXT O N N 180 MET H H N N 181 MET H2 H N N 182 MET HA H N N 183 MET HB2 H N N 184 MET HB3 H N N 185 MET HG2 H N N 186 MET HG3 H N N 187 MET HE1 H N N 188 MET HE2 H N N 189 MET HE3 H N N 190 MET HXT H N N 191 PRO N N N N 192 PRO CA C N S 193 PRO C C N N 194 PRO O O N N 195 PRO CB C N N 196 PRO CG C N N 197 PRO CD C N N 198 PRO OXT O N N 199 PRO H H N N 200 PRO HA H N N 201 PRO HB2 H N N 202 PRO HB3 H N N 203 PRO HG2 H N N 204 PRO HG3 H N N 205 PRO HD2 H N N 206 PRO HD3 H N N 207 PRO HXT H N N 208 SER N N N N 209 SER CA C N S 210 SER C C N N 211 SER O O N N 212 SER CB C N N 213 SER OG O N N 214 SER OXT O N N 215 SER H H N N 216 SER H2 H N N 217 SER HA H N N 218 SER HB2 H N N 219 SER HB3 H N N 220 SER HG H N N 221 SER HXT H N N 222 THR N N N N 223 THR CA C N S 224 THR C C N N 225 THR O O N N 226 THR CB C N R 227 THR OG1 O N N 228 THR CG2 C N N 229 THR OXT O N N 230 THR H H N N 231 THR H2 H N N 232 THR HA H N N 233 THR HB H N N 234 THR HG1 H N N 235 THR HG21 H N N 236 THR HG22 H N N 237 THR HG23 H N N 238 THR HXT H N N 239 TYR N N N N 240 TYR CA C N S 241 TYR C C N N 242 TYR O O N N 243 TYR CB C N N 244 TYR CG C Y N 245 TYR CD1 C Y N 246 TYR CD2 C Y N 247 TYR CE1 C Y N 248 TYR CE2 C Y N 249 TYR CZ C Y N 250 TYR OH O N N 251 TYR OXT O N N 252 TYR H H N N 253 TYR H2 H N N 254 TYR HA H N N 255 TYR HB2 H N N 256 TYR HB3 H N N 257 TYR HD1 H N N 258 TYR HD2 H N N 259 TYR HE1 H N N 260 TYR HE2 H N N 261 TYR HH H N N 262 TYR HXT H N N 263 VAL N N N N 264 VAL CA C N S 265 VAL C C N N 266 VAL O O N N 267 VAL CB C N N 268 VAL CG1 C N N 269 VAL CG2 C N N 270 VAL OXT O N N 271 VAL H H N N 272 VAL H2 H N N 273 VAL HA H N N 274 VAL HB H N N 275 VAL HG11 H N N 276 VAL HG12 H N N 277 VAL HG13 H N N 278 VAL HG21 H N N 279 VAL HG22 H N N 280 VAL HG23 H N N 281 VAL HXT H N N 282 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLU N CA sing N N 70 GLU N H sing N N 71 GLU N H2 sing N N 72 GLU CA C sing N N 73 GLU CA CB sing N N 74 GLU CA HA sing N N 75 GLU C O doub N N 76 GLU C OXT sing N N 77 GLU CB CG sing N N 78 GLU CB HB2 sing N N 79 GLU CB HB3 sing N N 80 GLU CG CD sing N N 81 GLU CG HG2 sing N N 82 GLU CG HG3 sing N N 83 GLU CD OE1 doub N N 84 GLU CD OE2 sing N N 85 GLU OE2 HE2 sing N N 86 GLU OXT HXT sing N N 87 GLY N CA sing N N 88 GLY N H sing N N 89 GLY N H2 sing N N 90 GLY CA C sing N N 91 GLY CA HA2 sing N N 92 GLY CA HA3 sing N N 93 GLY C O doub N N 94 GLY C OXT sing N N 95 GLY OXT HXT sing N N 96 ILE N CA sing N N 97 ILE N H sing N N 98 ILE N H2 sing N N 99 ILE CA C sing N N 100 ILE CA CB sing N N 101 ILE CA HA sing N N 102 ILE C O doub N N 103 ILE C OXT sing N N 104 ILE CB CG1 sing N N 105 ILE CB CG2 sing N N 106 ILE CB HB sing N N 107 ILE CG1 CD1 sing N N 108 ILE CG1 HG12 sing N N 109 ILE CG1 HG13 sing N N 110 ILE CG2 HG21 sing N N 111 ILE CG2 HG22 sing N N 112 ILE CG2 HG23 sing N N 113 ILE CD1 HD11 sing N N 114 ILE CD1 HD12 sing N N 115 ILE CD1 HD13 sing N N 116 ILE OXT HXT sing N N 117 LEU N CA sing N N 118 LEU N H sing N N 119 LEU N H2 sing N N 120 LEU CA C sing N N 121 LEU CA CB sing N N 122 LEU CA HA sing N N 123 LEU C O doub N N 124 LEU C OXT sing N N 125 LEU CB CG sing N N 126 LEU CB HB2 sing N N 127 LEU CB HB3 sing N N 128 LEU CG CD1 sing N N 129 LEU CG CD2 sing N N 130 LEU CG HG sing N N 131 LEU CD1 HD11 sing N N 132 LEU CD1 HD12 sing N N 133 LEU CD1 HD13 sing N N 134 LEU CD2 HD21 sing N N 135 LEU CD2 HD22 sing N N 136 LEU CD2 HD23 sing N N 137 LEU OXT HXT sing N N 138 LYS N CA sing N N 139 LYS N H sing N N 140 LYS N H2 sing N N 141 LYS CA C sing N N 142 LYS CA CB sing N N 143 LYS CA HA sing N N 144 LYS C O doub N N 145 LYS C OXT sing N N 146 LYS CB CG sing N N 147 LYS CB HB2 sing N N 148 LYS CB HB3 sing N N 149 LYS CG CD sing N N 150 LYS CG HG2 sing N N 151 LYS CG HG3 sing N N 152 LYS CD CE sing N N 153 LYS CD HD2 sing N N 154 LYS CD HD3 sing N N 155 LYS CE NZ sing N N 156 LYS CE HE2 sing N N 157 LYS CE HE3 sing N N 158 LYS NZ HZ1 sing N N 159 LYS NZ HZ2 sing N N 160 LYS NZ HZ3 sing N N 161 LYS OXT HXT sing N N 162 MET N CA sing N N 163 MET N H sing N N 164 MET N H2 sing N N 165 MET CA C sing N N 166 MET CA CB sing N N 167 MET CA HA sing N N 168 MET C O doub N N 169 MET C OXT sing N N 170 MET CB CG sing N N 171 MET CB HB2 sing N N 172 MET CB HB3 sing N N 173 MET CG SD sing N N 174 MET CG HG2 sing N N 175 MET CG HG3 sing N N 176 MET SD CE sing N N 177 MET CE HE1 sing N N 178 MET CE HE2 sing N N 179 MET CE HE3 sing N N 180 MET OXT HXT sing N N 181 PRO N CA sing N N 182 PRO N CD sing N N 183 PRO N H sing N N 184 PRO CA C sing N N 185 PRO CA CB sing N N 186 PRO CA HA sing N N 187 PRO C O doub N N 188 PRO C OXT sing N N 189 PRO CB CG sing N N 190 PRO CB HB2 sing N N 191 PRO CB HB3 sing N N 192 PRO CG CD sing N N 193 PRO CG HG2 sing N N 194 PRO CG HG3 sing N N 195 PRO CD HD2 sing N N 196 PRO CD HD3 sing N N 197 PRO OXT HXT sing N N 198 SER N CA sing N N 199 SER N H sing N N 200 SER N H2 sing N N 201 SER CA C sing N N 202 SER CA CB sing N N 203 SER CA HA sing N N 204 SER C O doub N N 205 SER C OXT sing N N 206 SER CB OG sing N N 207 SER CB HB2 sing N N 208 SER CB HB3 sing N N 209 SER OG HG sing N N 210 SER OXT HXT sing N N 211 THR N CA sing N N 212 THR N H sing N N 213 THR N H2 sing N N 214 THR CA C sing N N 215 THR CA CB sing N N 216 THR CA HA sing N N 217 THR C O doub N N 218 THR C OXT sing N N 219 THR CB OG1 sing N N 220 THR CB CG2 sing N N 221 THR CB HB sing N N 222 THR OG1 HG1 sing N N 223 THR CG2 HG21 sing N N 224 THR CG2 HG22 sing N N 225 THR CG2 HG23 sing N N 226 THR OXT HXT sing N N 227 TYR N CA sing N N 228 TYR N H sing N N 229 TYR N H2 sing N N 230 TYR CA C sing N N 231 TYR CA CB sing N N 232 TYR CA HA sing N N 233 TYR C O doub N N 234 TYR C OXT sing N N 235 TYR CB CG sing N N 236 TYR CB HB2 sing N N 237 TYR CB HB3 sing N N 238 TYR CG CD1 doub Y N 239 TYR CG CD2 sing Y N 240 TYR CD1 CE1 sing Y N 241 TYR CD1 HD1 sing N N 242 TYR CD2 CE2 doub Y N 243 TYR CD2 HD2 sing N N 244 TYR CE1 CZ doub Y N 245 TYR CE1 HE1 sing N N 246 TYR CE2 CZ sing Y N 247 TYR CE2 HE2 sing N N 248 TYR CZ OH sing N N 249 TYR OH HH sing N N 250 TYR OXT HXT sing N N 251 VAL N CA sing N N 252 VAL N H sing N N 253 VAL N H2 sing N N 254 VAL CA C sing N N 255 VAL CA CB sing N N 256 VAL CA HA sing N N 257 VAL C O doub N N 258 VAL C OXT sing N N 259 VAL CB CG1 sing N N 260 VAL CB CG2 sing N N 261 VAL CB HB sing N N 262 VAL CG1 HG11 sing N N 263 VAL CG1 HG12 sing N N 264 VAL CG1 HG13 sing N N 265 VAL CG2 HG21 sing N N 266 VAL CG2 HG22 sing N N 267 VAL CG2 HG23 sing N N 268 VAL OXT HXT sing N N 269 # _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _atom_sites.entry_id 2RO4 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_